KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105184125Help
Entry
105184125         CDS       T03918                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hst00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    105184125
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hst03012]
    105184125
Translation factors [BR:hst03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    105184125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 105184125
NCBI-ProteinID: XP_011140983
Position
Unknown
AA seq 1111 aa AA seqDB search
MARYGQRPENALKRAYEFIEVGKPARALDTLQEVFRNKKWTYSWSESVLEPIMYKYLDLC
VELKKSHIAKEGLFQYRNMFQSVNVGSLENVIRSYLRMAEEKTNAARKQSQQAVIDIDDL
DNLATPESILLSAVSGEDAQDRSDRTILTPWVKFLWESYCQCLELLRTNAHVETLYHDIA
RMAFQFCLEYNRKTEFRKLCEKLRKHLEEICKLPQLVSNVSMNKAETQQLNLETRLNQLD
SAIQMELWQEAFKSSEDVHGMMNLSKKLPVPKTMANYYQKLAMVFWKAGNFLFHAAALFK
LLQLSREMKKNMSSEEQQRMANRVLLATLSIPLPSAHPEFDRFIETDKSPLEKAQKLATL
LGLSQPPTRVSLLKDIVRLNVVMLASPQLQELYSWLEVEFHPLELCGRVDSVIQTLQADE
NSPLTQYVPALQDVTLVRLVHQISQVYQTIQFSRLLELAKFTTDFHLERLLVDCVRYNDM
QIRIDHGKTCVHFGVDLSEAQREDHPDGPVLQAMPSEQIRCQLVNMATVLHRAINVINPN
KKKLEREKMRSAMVGHYHETKMKEHQRILGRHKIIEERKEYIEHINTVREEEEMRRQEEL
QRQQMLAEQKRMEQEREERERKRQQSEIQQIKDRHLKEKMQQISQTSHGQKVLKKLDEDE
IKKLDAEQIAAREAEELQKERREMQQKLKSQEKKVDYLERAKRLEEIPLLEKAVEEKMEL
AKQCWKQQEDERIAATVEERQQAVATRERMARMKADHDIFLAKILAERKNIYLEKQKEYD
KLLNEERAKRLLQRKNQRKAERKAKWEKERAEAAERRRLEELRIKQEEEKKRLEEERAKR
EEEERVRRAEEEAREAERLAKLKKQSEIMRNREAEIERKLEEERQRTKELTATWRRNPER
DQERERDGPKPAMESWRRNPDPKDSNGLKSEAERWRKRDDKIEESSWKRREPERRDMDKW
RRNDDSDRWKDSMEKWRDNYDRDDRERDRDRERDRDRDRERDRDRERDRDRDRDRDRGMD
GGRSIREIPRDPMLSSDRDRGRMSDRRGGYRRDEPVRNTNQDWRKRDPPPDSPRDPPKRE
REERKEEKLPPRPDERRRPLEDDGWSKVSRR
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgatacgggcagcgtcccgagaacgccctgaaacgggcgtacgaatttatcgaa
gtgggcaagccagctcgggcattagatacactgcaggaagtcttccgtaacaaaaaatgg
acgtacagctggtcagagtctgtactggagcccataatgtacaagtacttggacctatgt
gtggaactgaaaaagtcacacatagccaaggagggtctgttccagtacaggaacatgttc
caatctgtcaatgtcggcagtttggagaacgtcatacgcagctacctgagaatggctgag
gagaagacgaacgcagctcgcaagcagagccagcaagcggtgattgacattgacgatctt
gacaatctcgctacgccagagagcatcctactgtccgcggtgagcggcgaggacgcccaa
gacagaagcgaccgcaccatattgacaccttgggtgaagttcttgtgggaatcatactgc
caatgcttggagttgctcagaaccaacgcgcatgtggagactctctaccatgacatcgcg
cgtatggccttccagttttgcctcgagtacaatcgtaagactgaatttcgtaaattgtgc
gagaaattgcggaagcatctcgaagagatctgcaaactgccgcagctggtctcgaacgtc
tccatgaacaaggcggagacgcagcaactgaatctcgaaaccagattgaatcaattggac
tcggcaatacagatggagctctggcaagaagccttcaagtcgtcggaggacgtgcatggc
atgatgaacttatcgaagaagttaccggtcccaaagaccatggccaactactaccagaaa
ctggcgatggttttctggaaagccggcaatttcctgtttcacgcggccgcgctgttcaag
ctgttgcagctgtcccgcgagatgaaaaagaacatgtcgtcggaggagcagcagcgaatg
gccaaccgggtgttactagcaaccttgtcgataccattaccgtccgcgcatcctgaattc
gaccgcttcatagagacggacaagagcccgctggagaaggcgcagaagctcgcgacgctc
ttgggcctctcgcaaccacccactcgcgtttctctgctcaaagatatcgtgcgcctgaac
gtggtgatgctcgcgtcgccgcagctgcaggagctgtactcgtggctggaggtggagttt
cacccgttggagctctgcggcagagtcgactccgttatacaaacgctgcaggcggacgag
aacagcccgttgacccaatatgtccctgcgttgcaggacgttacgctcgtgcgtcttgtt
caccagatctcccaggtctaccagaccatccagttctcccggctgctggagctcgccaag
ttcacgaccgacttccacttggagcgtctgctggtggactgtgtgcgctacaacgacatg
cagatcaggatagatcacggcaagacttgcgtacactttggcgtggacctgtcagaggcg
caacgggaggatcatccggacggcccggtgctgcaggcgatgccgtccgagcagatacgc
tgccagctcgtcaacatggcgaccgtgctgcaccgcgctatcaatgttatcaatcccaac
aagaagaagctggagcgggagaagatgcgtagcgcgatggtcggccactatcacgagacc
aagatgaaggagcaccagaggatattggggaggcacaaaatcattgaggagaggaaggag
tacatcgagcacatcaacaccgtccgcgaggaggaggagatgcgcagacaggaggaactc
cagcgacagcagatgctggccgagcagaagaggatggagcaagagcgcgaggagcgcgag
cggaaacgccagcagagcgagatacagcagatcaaggaccgccacctgaaggaaaagatg
cagcagatctcgcagaccagtcatgggcagaaggtgttgaagaagctcgacgaggacgag
atcaagaagctggacgcggagcagatcgcggcgagggaggcggaggagctgcagaaggag
cggcgggaaatgcagcagaagctcaagtcgcaggagaagaaggtcgactacttggaacgc
gcgaaacgcctcgaggagatcccgttgctggagaaggcggtggaggagaagatggagctg
gcgaaacagtgctggaagcagcaagaggacgagcgaatcgccgcgaccgtcgaagagagg
cagcaggctgttgcgacgcgagagcgtatggcacgcatgaaggccgaccacgacatcttc
ctcgccaagatcctggctgagcgtaagaacatatatctggagaagcagaaggagtatgac
aagctgctgaacgaggagcgcgccaagaggttgttgcaacgcaaaaatcagcgcaaagcc
gagcgcaaggccaagtgggagaaggagcgcgccgaggccgcagaacgacggcgcctggag
gagctgcgcatcaagcaggaggaggagaagaagcgcttggaggaggagagggccaagagg
gaagaggaggagagagtcagacgggccgaggaggaggccagagaagcggaacgtttggcc
aagctcaagaagcagtctgagatcatgcgaaacagggaagccgagatcgaacggaaactc
gaggaagaacgccagcggaccaaggaactgacggcaacatggcggcgtaatcccgaaaga
gatcaggaacgtgagcgtgatggcccgaaacctgcaatggagtcatggcggcgtaatccc
gaccccaaggattccaacggactcaagagcgaagcggagcgctggaggaagcgggacgac
aaaatcgaggagtcttcatggaagaggagggaaccggaacgacgcgacatggacaagtgg
agaagaaatgacgactcggatagatggaaggacagtatggagaaatggagggacaactac
gatagagatgatcgcgagcgtgatcgcgaccgtgagcgtgatcgtgatcgtgaccgcgaa
cgtgatcgtgatcgcgaacgtgatcgtgatcgtgatcgtgatcgcgatcgtggaatggac
ggcggtcgctcgatacgcgaaattcctcgggatccgatgctatcatccgatcgagaccgc
ggcagaatgtccgaccgtcgcggtggttatcgacgtgacgagcctgtacgaaacaccaat
caggactggcgcaaacgcgacccacctccagactctcctagagatccacccaagcgagag
cgagaggaacgcaaggaagagaaacttccgcctaggcccgacgaaagaaggcggccactg
gaggatgacggctggtcaaaagtcagtcgacgctaa

DBGET integrated database retrieval system