KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105185759Help
Entry
105185759         CDS       T03918                                 

Definition
(RefSeq) uncharacterized protein LOC105185759 isoform X1
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst04013  MAPK signaling pathway - fly
hst04214  Apoptosis - fly
Brite
KEGG Orthology (KO) [BR:hst00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105185759
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105185759
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hst01009]
    105185759
Enzymes [BR:hst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105185759
    3.1.3.48  protein-tyrosine-phosphatase
     105185759
Protein phosphatases and associated proteins [BR:hst01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    105185759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese Y_phosphatase PTPlike_phytase Init_tRNA_PT NicO
Motif
Other DBs
NCBI-GeneID: 105185759
NCBI-ProteinID: XP_025156564
Position
Unknown
AA seq 651 aa AA seqDB search
MSAKISAAGHDAATQSTVSHRAARASPVKRPLSPEATGITERSPKRAAVPELKSSSNGIS
GRLSSSERTSEMPALTRVCSPATLPRLKRFRFRPIDAPSPGPCHDVSITDVNSNHHHPPH
NQNEHRPQDSRNSPSSSMSTLLCCEPVSAGRPRANLKLVLNRSLSEPGPNPCSFPASPTV
SPLASIVSNGNPADTPDVIDEETNGDGVGNEDDEAHRRYHHLHYHHHHHHHHHHHHHQHH
HHLLSATTKRCKLETVSLPNSPCGENGTLHRQLVLSKTRVITSGDLAQRLAVERPTTAAP
VILDCRPFILYNVNHVRGAINVNCSDRFNRRRLQLGKATLADLATAREGKELLRKRQFRE
VVVYDDCTDDLDHLPAQHPLFLVLAALVDDDQEPALLIGGHREFHRRHRELCEDTLLPSG
GSNGVGGGGGGGGGGDPSATTVSGCTSPGLGCPVLSVSVLPTPQPADIDSHPASRVLPFL
YLGNGRDAADLQLLRALGATRVLNVTSQLPGYHEERGITYRQIPASDSSHQNLKQYFEEA
FDFIEEARKAGSSVLVHCQAGVSRSATIAIAYIMRHKGLSMVEAYKLVKNARPIISPNLN
FMGQLLELEQGLRASGGVGSSGASEEPTTGCHQCRWSHQPNSEEVTSGCSV
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccaagatatcggcggctggccacgatgccgcgacacagtcaacagtgagccat
cgtgccgcgagagcgtcgcccgtcaagagaccgctgtcaccggaggccactggcatcacc
gagagatcaccgaaacgcgcggccgttccggagctgaaatcgtcctcgaacggaatttcc
ggccgactgtcgagcagtgaacgtaccagcgagatgccagccctgacgagagtttgttcc
cctgcgacattgccgaggctcaagagattccgtttccgaccgatcgatgcaccgagccca
ggaccgtgccacgacgtgagcatcaccgacgtaaattccaatcatcaccatccaccgcac
aaccagaacgaacatcggcctcaggattcccgaaattcgccgtcctcctcgatgtctact
ttactatgctgcgagccagtgtcagctggccggccacgggccaatctcaagctcgtgctg
aatcgcagcttaagcgagccaggaccgaatccctgcagcttccctgcttcgcccactgtc
tcgccgctcgcgtctatcgttagcaacggtaaccctgccgatacgccggacgttatcgac
gaggagacgaacggggacggtgtagggaacgaagacgacgaggctcatcgtcgttatcac
caccttcactatcaccatcatcatcatcatcatcatcatcatcatcaccatcagcatcat
caccatctcctctcggccactacgaagcgctgcaaactggagaccgtcagtttgcccaac
agtccgtgcggggagaacggtaccctccatcgtcagctggtgctaagcaagacacgtgtt
atcacttccggtgatttggcccagcgtctcgcggtcgagcggcccaccaccgccgctccg
gtgatcctcgactgccgaccgtttatactatacaacgtcaatcacgtgcgcggcgccatc
aatgtcaactgctcggatcgcttcaaccggcgcaggctgcagctgggtaaagccacgctg
gccgatctcgcgaccgcccgcgagggcaaggagctgctcaggaagaggcaattcagggag
gttgtggtgtacgacgattgcaccgacgacctggatcatctgcccgcccagcacccgttg
ttcctagtgttggccgcgcttgtggacgacgatcaagaaccagccctgttgatcggtgga
caccgcgagttccacaggcgacaccgggaactatgcgaggacacgctcttaccgagcggc
ggtagcaacggtgtcggaggtggcggcggcggcggcggtggcggcgatccttcggcgacg
acggtgagcggctgcacgagtcccgggcttggttgtcccgtgctaagcgtctccgtctta
cccacaccgcagcccgccgacatcgacagtcatccggcgtcccgtgtgctgcctttcctc
tacctcggcaacggcagggatgccgccgacctgcagctactgcgcgcgctcggcgccacc
cgggtgctgaacgtcacctcgcagctgcccggctaccacgaggaacggggtatcacgtac
aggcagataccggcctcagactccagccaccagaacttgaagcagtacttcgaggaagcg
ttcgatttcatcgaggaagcgcggaaagccggtagcagcgttctggtgcactgtcaagcc
ggcgtgtcgcgcagcgcaacgatcgccatcgcctacataatgcggcacaagggcctgtcg
atggtggaagcgtacaaactggtgaagaacgcgcgcccgatcatcagcccgaacctcaat
ttcatgggtcagctgctggagctggagcaaggtttgagggcgtctggcggcgtcggcagc
tccggagcgtcggaggaacccacgacgggttgccaccagtgcaggtggagtcaccaaccc
aacagcgaagaggtcacctccggctgcagcgtctga

DBGET integrated database retrieval system