KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105186207Help
Entry
105186207         CDS       T03918                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00010  Glycolysis / Gluconeogenesis
hst00562  Inositol phosphate metabolism
hst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105186207
   00562 Inositol phosphate metabolism
    105186207
Enzymes [BR:hst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105186207
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105186207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 ELM2
Motif
Other DBs
NCBI-GeneID: 105186207
NCBI-ProteinID: XP_011144550
UniProt: E2BSX4
Position
Unknown
AA seq 438 aa AA seqDB search
MLKWLIAILCIAIANISLDYTSFIQDESYKCKLGAKTPYRCVANYNDTPIKYSGCTEKKI
WLLLRHGTRYPGKKYIPRMLDELPKWKHIILKNYDNGETRLSADDAALFKKWKPIFTSSD
TMKLAIEGENEMIDLGERYQARFPSLMPEVYSNQTYKFRYTSTQRTEESAKHFAVGLFGW
QKSQSVWYPEPAYRDPVLRFYKACPRWRQEVDKNPNAKAEKNKFLDSKIVTDMLNNIKDY
IGHYVNYETAFLMYSMCAFETAWDQNIVSPWCKIFSLNDFKVFEFAEDLGLYWIDGYGYQ
LTYQQACPVLKDMFDFFVSNKSLITTVYFTHSGTILKLLSLLGVAKDTYPLMHNSFTLHE
EDKRAWKTSIIDAFASNIAFVLYDCLSQGPSILFMLQERPVYLPNCPRNMPCSISTMKAT
YPDNDEECLFHAMCNIST
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagtggctaattgctatactttgtatagcaattgcaaatatttctttggactat
acttctttcatccaagatgaaagttacaaatgtaaactaggagccaaaactccatataga
tgtgtagctaattataatgatacaccaataaaatattcaggttgtacagaaaaaaaaatc
tggttgcttctacggcatggcaccagatatccaggcaaaaagtatatacctcgtatgtta
gatgaattgccaaaatggaaacatataatattaaagaattatgataatggtgaaacaaga
ttgtcagctgatgatgctgctttatttaaaaagtggaaaccaatatttacttcaagtgat
acaatgaaattagcaatagagggtgaaaatgaaatgattgatcttggggaaagatatcaa
gcaagatttccatctctgatgccagaagtctacagcaatcagacctacaaattcagatat
acttcaactcaacgcacagaggagagtgcaaaacattttgctgttggattatttggttgg
caaaaaagtcagtctgtttggtatccagaaccagcatacagagatcctgtgttgagattt
tacaaagcttgtcctcgttggcgtcaagaagttgacaagaatccaaatgcaaaagcagaa
aagaacaaatttttggatagcaagattgttactgatatgttaaataatattaaagattat
attggccactatgtcaattatgaaactgcatttttaatgtattccatgtgtgcctttgag
actgcttgggatcaaaatatagtatctccttggtgcaagatattttccttaaatgatttt
aaggtatttgaatttgcagaagatttagggctttattggattgatggatatggataccag
ttaacttatcaacaagcatgtcctgtcttaaaagacatgttcgacttctttgtgtccaac
aaaagcctaataacaacggtttattttacacattctgggacaattctaaagttactgtct
ttacttggagtagctaaagacacatatcctttaatgcacaattcttttacattgcatgag
gaggataaaagagcatggaagaccagtattattgatgcatttgcatctaacattgcattc
gtcctatatgattgtctatctcaaggtcccagtattctgttcatgcttcaagaacgacca
gtatatttgccaaactgcccaaggaacatgccatgttcaatatctactatgaaagctaca
tatccagataatgatgaggaatgtctatttcatgctatgtgcaatatatcaacgtaa

DBGET integrated database retrieval system