KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105188268Help
Entry
105188268         CDS       T03918                                 

Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00480  Glutathione metabolism
hst00980  Metabolism of xenobiotics by cytochrome P450
hst00982  Drug metabolism - cytochrome P450
hst00983  Drug metabolism - other enzymes
hst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105188268
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    105188268
   00982 Drug metabolism - cytochrome P450
    105188268
   00983 Drug metabolism - other enzymes
    105188268
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hst02000]
    105188268
Enzymes [BR:hst01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105188268
Transporters [BR:hst02000]
 Other transporters
  Pores ion channels [TC:1]
   105188268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG NAPRTase_C
Motif
Other DBs
NCBI-GeneID: 105188268
NCBI-ProteinID: XP_011147928
UniProt: E2BZH4
Position
Unknown
AA seq 149 aa AA seqDB search
MANINPEILKVFGFWGSILVLKMLAMIPLTARQRFRKQVFANPGDVTMLKNSVPKGKVVY
DDPDVERVRRAHLNDLENIVPWFIITYIWLCTEPSIVLAKVLIRTFVLSRIVHTLSYAVM
PQQPLRAISFFVGFGILGFEALTSLLHYS
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatatcaatccggagatcctcaaggtgttcggcttttggggcagtatactagtc
ctgaagatgttggcgatgataccattaacggcacgtcagcgttttcgaaaacaggtattt
gccaatcccggcgatgttaccatgctgaagaactcggtgccgaaggggaaggtggtatat
gacgatccggacgtggagcgcgtgcgaagggcgcacttgaacgacctggagaacatcgtg
ccgtggttcatcatcacgtacatctggttgtgcaccgagccctcgatagtgctggcgaag
gtgctgatacgtaccttcgtgctctcccgaatagtccacactttgtcgtacgcggttatg
ccgcaacagcccctaagagctatatctttcttcgtcgggttcggcattctcggtttcgag
gcgctcacctcgttgttacattactcgtaa

DBGET integrated database retrieval system