KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105188577Help
Entry
105188577         CDS       T03918                                 

Definition
(RefSeq) F-box/LRR-repeat protein 4
  KO
K10270  F-box and leucine-rich repeat protein 4
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Brite
KEGG Orthology (KO) [BR:hst00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hst04121]
    105188577
   03029 Mitochondrial biogenesis [BR:hst03029]
    105188577
Ubiquitin system [BR:hst04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     105188577
Mitochondrial biogenesis [BR:hst03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    105188577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-box-like F-box F-box_4 SAP30_Sin3_bdg
Motif
Other DBs
NCBI-GeneID: 105188577
NCBI-ProteinID: XP_011148408
UniProt: E2C0C4
Position
Unknown
AA seq 683 aa AA seqDB search
MISHEEIKFEAISINKETTTGKRESITFIEQFVKDVCDFSSQYGSNISISYTAYNIAGNP
SKFPDYGDFPQAFVMRTYGPWWDKAPSKPIDYMPQNNENIVSQDYIDIEYYQEVYPVRVS
VYETYNPGSVIAIWAQDCYGQWFQLWSGPSQIVPHKPRIFSPHLQLCNFKTKMLRLEFNH
SLLDYYTELDAVLLIGTSELIIPNDRQHNQNLNNLLQELSCIDLHNEDVHNLTPDYLNAN
QDLVILKKTLHTHCTVYKSKIIENFPKSKLISKLGQHYRCVPPVEEAFNSLQQFLQEEFP
KLIKDIYLSSSTSLYGSKLLPIKSSSSTLNESEEPPCGSFSALPDETVLKILKNLDLRSL
CRLCRVNKHFNNIARDALLYTCLNLKPYWYCLDTQALNNLAPRCQYLRQLDLSWCGNYNM
FKYQNIVNFLNTCGSLLTHLRLNCCHIVNDIVISEVSKICKNLKELCLRNCLEITNEGFS
KLENLEFLERLELYRTTIETSTLCSILRKNPRMRHLNVAGTHERLNVDEIAVELGNSCPY
LESVDFWKAQTFTPHGLRALARCKNLREVDFGWCGGMGAPGDSLRALLSSCQHLEKVFLA
ALRGLTDRDLEPLLLCQYLQQLDLLGARSLTPDICYGFLLCCPKLEMIDLSFCESISDSK
IHEWRQQYPHVSIKRSFQAIEPI
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgatatctcatgaggagattaaatttgaggcaatatctatcaacaaagaaacgactacc
ggcaagagagaatctatcacctttattgaacagtttgtcaaagatgtttgtgactttagt
tcccagtatggcagcaatatcagcatatcgtatactgcttacaacatagctggtaatcct
agcaagtttccggactatggagattttccgcaagcatttgttatgagaacttatggacca
tggtgggacaaagcaccttcaaaaccaatagattatatgcctcagaataacgaaaatata
gtgagtcaggattatatcgatattgaatattaccaagaagtatatccagtcagagtttct
gtatatgaaacatataatcctgggagtgtaattgcaatttgggcacaagactgttatggc
caatggtttcagttatggagtggaccatctcagattgtccctcacaaaccacgaatattt
tctccacatttacaactgtgtaacttcaagaccaaaatgttaagactggagttcaaccat
agcctattagactactatacagaattagatgctgtgttgcttattggtacatctgaattg
atcattcctaatgatcgacagcataatcagaatttaaataatctattgcaagaactaagc
tgcattgatctacacaatgaagatgttcataatctaacaccagattacttaaatgcaaac
caggatttagtcattctaaaaaaaacactacatacgcattgtacagtgtataaaagcaaa
ataatagaaaatttccctaagagcaagttaatatcaaaattaggacaacattatcgttgt
gtaccgcctgttgaagaggcattcaatagtctgcaacaatttttgcaagaagaatttccg
aagcttataaaagacatttatctttcctcatcaacctctttatatggatcgaaattattg
cctattaaaagttcgtcgtcaactctgaacgaatctgaagaaccaccatgtggcagtttt
tctgcacttcctgatgagacggtgctaaagatattgaaaaatttagacttgagatcgctg
tgtcgcttgtgcagagtgaacaagcattttaacaatatagcgagggatgctttactctac
acatgtttgaacttaaagccgtattggtactgtctcgatacgcaagcattgaacaatttg
gcacctagatgtcaatatctacgacagttggatctctcatggtgtggtaactacaatatg
tttaaatatcaaaatatcgtaaactttcttaacacatgcggtagtcttttgacgcattta
cggttaaattgctgccacatcgttaacgatatcgttatctctgaagtgtcaaagatatgt
aaaaatttaaaagaattgtgcttgcgtaattgtttggaaataacgaatgaaggtttttcc
aagcttgagaatttagaattcctcgagcgtttggaactttacagaacaactattgaaact
tcgacactgtgctcaatattgcgaaagaaccctcggatgcgacatttgaatgtagcggga
acacacgagcgtttgaacgtggacgagatcgcggtggaattaggaaattcatgtccatat
ttggaaagtgtggatttttggaaagcgcagacttttacaccgcacggtcttcgtgctctc
gctcgttgtaagaatttgcgggaagtggattttggttggtgtggtggtatgggtgctcct
ggagattctttgcgcgcactgttatcttcgtgccaacacttggagaaagtcttcctggcc
gctcttcgaggactcacggatcgcgatttggaaccgttattactatgccaatacttgcaa
caattagacctattgggtgctcgatctttaacaccagatatttgttacggattcttgttg
tgttgtcctaaattagaaatgatcgatctgagtttctgcgaaagtatcagcgactccaaa
attcatgaatggcgacaacaatacccgcatgtatccatcaaaagaagctttcaagcaatt
gaaccaatttag

DBGET integrated database retrieval system