KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105189856Help
Entry
105189856         CDS       T03918                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial isoform X2
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00071  Fatty acid degradation
hst01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105189856
Enzymes [BR:hst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     105189856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 105189856
NCBI-ProteinID: XP_011150518
Position
Unknown
AA seq 628 aa AA seqDB search
MLTRNGLRKIIINRRGVELVQHVARSTVTAHDTNEYQYMQFSKIPTLHFQKSLPRLPIPK
LEDTCRRYLNAQKPLLDDKDLQNTSSYVSKFLANEGQSLQKQLLQHDAENSHTSYISEPW
FDMYLRDRKPLPINYNPFLVFIPESDPKYDEQLVKATNLVISSMRFLKSLRENILEPEVF
HLNPEKSDTNLFRNVTRLIPSHFSYYGAYLFKAYPLDMSQYKNLFNTTRIPELEKDRIFH
DPSAKHLVVMRKGHFYAFDVLDANGAIRGPKEIAACLKAILEDNRAPNKHPVGILTTSER
DQWAQARSHLFKTGNQEILNKIDSAVYIITLDDEVLDGYGGMNFEHSWGDGVAVLRFFQD
MKADISKKPRFHPDEVGELAKESANIERLEFSIDAKSESLINQEIAKYRKWTDRLCVDHI
IYEEFGKEQCKKLGVSPDAIMQLTFQLALYILEGKLVSTYESCSTAAFKHGRTETIRPCT
LATKAICTAMAQNNSKLSKSELKKMIKDCSKAHNVLTREAVMGQGFDRHLFALKKISEKS
NYNMSAIFHDPAYHAINYNILSTSTLSSPDVLAGGFGPVVPDGYGIGYMIQEKRLGAVVT
TYEGSRNASKYIQTLAHAFKNICDVLHT
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgttaactagaaacggactccgtaaaattataattaatcgtcgaggagtggaactagta
caacatgtagctaggagtactgtaactgcacatgataccaatgaatatcaatatatgcaa
tttagtaaaattccaacattgcattttcaaaaatctttaccacggttaccaataccaaaa
cttgaagatacatgtagaagatatttaaatgcacaaaaacctctattggatgataaggac
ttgcaaaatacatcttcttatgtctcaaaatttcttgccaatgaggggcagagtttacaa
aagcagctacttcaacatgatgctgagaattcacacactagctacattagtgaaccatgg
tttgatatgtatttgcgtgatcgcaagcctttgccaattaattacaatcctttcttagta
tttataccagaatctgatccaaaatatgatgaacaattggtgaaggctacaaatcttgtt
atatcttcaatgagattcttgaagtctctcagggaaaacatcttagaaccagaagtgttt
catttgaatcctgagaaatcggatactaatttatttcgaaatgtcacaagattgattcca
tctcattttagctattatggtgcttatttatttaaggcttatccattagatatgtcacaa
tataagaacttgttcaatacaactagaataccagaattggagaaggataggatcttccac
gatccttccgcaaaacatttggttgtaatgaggaaaggacacttttatgcgtttgacgtt
ttagatgcaaacggcgctattcgtggccccaaagaaatagccgcatgtttaaaagctatt
ttggaagataatagagcaccaaataaacatcctgtaggcatccttactacttcagaaaga
gatcaatgggcacaagcacgttcacatttattcaagacgggaaatcaagaaattttaaac
aagatcgattctgctgtgtacataataaccttggatgacgaagttttggatggctatggt
ggaatgaattttgaacactcgtggggcgacggtgttgcagtattgagattctttcaggat
atgaaggccgacatatcaaagaaacccagatttcatcctgatgaggtaggtgaacttgca
aaggagagtgcaaacattgaaagacttgaattctctatagatgctaaaagtgaaagtctt
atcaaccaggagatagctaagtatagaaaatggactgatagactatgcgtagatcatata
atttatgaagaatttggtaaagagcaatgtaagaagcttggagtgagtccagatgctata
atgcaattgacgttccaattagcattgtatattctggaaggcaaattagtatcgacttat
gaatcttgcagcactgctgcatttaagcatggaagaacggaaactattagaccttgtaca
ctagcgactaaagcaatatgtactgctatggcccaaaacaatagcaaactttctaaatca
gaattgaagaagatgataaaggattgtagcaaagctcacaatgtgcttacgagagaagct
gtaatggggcaaggatttgacagacatttattcgccttgaagaaaatatcagaaaagtca
aattacaatatgtcagccatttttcacgatccagcgtatcatgctataaattataacata
ttatctacatctactttatcaagtccagatgtactggcaggcggatttgggccagtggta
cccgatggatatggaataggatatatgatccaagaaaaacgattgggtgctgtcgtgaca
acttacgaaggtagtcgtaatgccagcaaatacatacaaacattagcacacgcattcaaa
aatatttgtgatgtgttgcatacgtaa

DBGET integrated database retrieval system