KEGG   Harpegnathos saltator (Jerdon's jumping ant): 105190713Help
Entry
105190713         CDS       T03918                                 

Definition
(RefSeq) protein henna isoform X1
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
hst  Harpegnathos saltator (Jerdon's jumping ant)
Pathway
hst00360  Phenylalanine metabolism
hst00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hst00790  Folate biosynthesis
hst01100  Metabolic pathways
hst01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hst00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    105190713
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    105190713
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    105190713
Enzymes [BR:hst01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     105190713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biopterin_H ACT
Motif
Other DBs
NCBI-GeneID: 105190713
NCBI-ProteinID: XP_011151900
UniProt: E2C764
Position
Unknown
AA seq 464 aa AA seqDB search
MYAQRAPQTSDEIEKKIRDNIPPDTPKLIHGGNYIREGWDSAKSTCLIFCPKEEDEIGSL
GRYLQMFAKHKVNLLYIESRSSLRQPNGYEFMVECAPGSNISSAIESLRNQCSYFSIISR
NHRDNLDTVPWFPRRIRDLDKFANQILSYGAELDSDHPGFTDPVYRKRRKYFADIAYHYK
HGQPIPKVEYTAEETATWGEVFRHLTKLYPKYACREHNHVFPLLIENCGYRENNIPQLQD
ISNFLKDSTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHSSKPFYTPEPDVCHEVLG
HVPLFADPAFAQFSQVVGLASLGAPDDYIEKLATCFWFTVEYGLCLQNGELKAYGAGLLS
SYGELEYCLSDKPELRPFDPPKTAMQKYPITEYQPVYFVAENFEDAKERMIKFAQTIPRK
FGVRYDPYTQSINIIDSKQQVETLANNLNQEVQILVDSLRKLQH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtatgctcaaagagccccgcaaacgtcggacgaaattgaaaagaagatacgcgacaat
atacccccagacacgccaaaacttatccatggagggaactacatcagagaaggctgggac
tcggccaaaagtacctgcctgatcttttgccccaaggaagaagacgagattggttcactg
ggacgatatctccaaatgttcgctaaacacaaggtgaatctcttgtacatcgagtccaga
agttccctccgtcaaccgaacggctatgaatttatggtggaatgcgcgccgggcagtaat
atctcctccgcgattgaatctctgcgaaaccagtgcagctatttttcaatcatttctagg
aatcacagggacaatctggacactgtgccgtggttcccgcggagaatacgcgatctcgac
aagttcgctaatcaaatcttgtcgtacggcgcagagctcgacagcgatcatcccggcttc
accgatcccgtctacagaaagaggaggaaatatttcgccgacatcgcttaccattacaaa
catgggcaacccattccgaaggtagaatacacggcggaggagacagcgacgtggggtgag
gtcttcaggcatttgacgaaactctatccaaagtacgcttgcagagagcacaatcatgtt
ttcccgttgctcatcgagaactgcggttaccgtgagaacaacatacctcagctccaggat
atatcgaattttttgaaagactccaccggcttcactctgcgtcctgtggcaggactgctg
tcctcgcgcgattttctcgccggtttggccttcagggtgtttcacagcacgcagtacata
cgacacagcagcaagccgttctacacgccagaaccggacgtgtgccacgaggtcttgggc
cacgtacctcttttcgccgatccggcctttgcgcagttctcgcaggtcgtcggtttggca
tccctaggtgctccggatgactacatagagaaactcgctacgtgcttttggttcacggtg
gagtatgggctatgcttgcaaaatggggaattgaaggcgtacggcgccgggttgctttcg
tcttacggcgagttggaatattgcttgagcgacaagccggaattgcgaccgtttgatccg
ccaaaaacagcaatgcagaaatatccaataaccgaatatcaacccgtgtactttgtggcg
gaaaattttgaagatgccaaggaaaggatgatcaaatttgcccaaactataccgaggaaa
tttggcgtcagatatgatccttacacgcaaagtatcaacattatcgacagtaaacaacaa
gtggaaactcttgcaaacaacttgaaccaagaagtgcaaatcttggtagactctttgagg
aagctgcagcattaa

DBGET integrated database retrieval system