KEGG   Halanaeroarchaeum sulfurireducens HSR2: HLASF_0110Help
Entry
HLASF_0110        CDS       T03927                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hsu  Halanaeroarchaeum sulfurireducens HSR2
Brite
KEGG Orthology (KO) [BR:hsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HLASF_0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AKH96624
UniProt: A0A0F7PAE6
Position
complement(108673..109845)
Genome map
AA seq 390 aa AA seqDB search
MTGAGLATIVVAAAASLFTAWVIGAGSSGSTPFAPAVGANAISVMRAGFYVGILGFAGAV
LQGANVSEAIGAELIHGVSLSPLAATVALTTGATLVAIGVFTGYPIATAFTITGAVVGVG
LAMGGDPAWAKYRQIATLWVGVPFVGGGIAFGTARTLRDTDRVRLTVPALAALVGIVLAN
VRFELLGPAESSRSIAGAAAHAVAGGNPLVGAGAGVAFALAIGGIVRWDLARSVEGAQRR
FLVALGSLVAFSAGGSQVGLAVGPLLPLLGDTVPLEFVLVGGGIGLLVGSWTSAPRMIKA
VSQDYSSLGPNRSIAALIPSFVIAQTAVFFGIPISFNEVVVSAIVGSGLAVGSSGVSRQK
MGYTVLAWVGSLAISLVVGYGAYLTAIRLL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtgctggtctcgcgacgatcgtggtcgctgccgcggcgagcctgttcacggcc
tgggtcatcggcgcgggctcctcggggtcgacgccgttcgctccggccgtcggcgcgaac
gcgatctcggtgatgcgggcggggttttacgtgggtatcctcggtttcgcgggcgccgtc
ctccagggagcgaacgtctcggaggcgatcggcgcggagttgatccacggcgtatcgctg
tcgccgctcgcggcgacggtcgcgctgacgaccggcgcgacgctggtcgcaatcggcgtc
ttcacgggctaccccatcgccacggcgttcacgatcacgggcgccgtcgtcggcgtcggg
ctggcgatgggtggcgatccggcgtgggcgaagtaccgccagatcgcgaccctctgggtc
ggtgtccccttcgtcggcggcggcattgccttcggaacggcacggactctacgagacacc
gaccgggtgcggctaacggtgcccgcactcgcggccctcgtgggaatcgtcctggcgaac
gtccggttcgaactcctggggccggcggaatcctcgcgttccatcgccggggcggccgcc
cacgccgtggccggcggtaatccgctcgtcggggcgggcgccggcgtcgcgttcgcgctc
gcaatcggtggcatcgttcggtgggatctcgccaggagcgtcgagggtgcccaacggcgg
ttcctggtcgcactcggatcgctcgtcgcgttctccgccggtgggagccaggtcggcctg
gccgtcgggccactcttgccgctcctgggcgacaccgtgccgctcgagttcgtcctcgtg
ggcgggggaatcggtctcctcgtcggttcgtggaccagcgcgccgcggatgataaaggcc
gtctcgcaggactactcctccctggggccaaaccgttccatcgccgcgctcatcccgtcg
ttcgtcatcgcccagacggcggtcttcttcggtatcccgatctcgttcaacgaggtggtc
gtgagcgcgatcgtgggcagcggcctcgccgtcggctccagcggggtcagccggcagaag
atgggatacaccgttctggcctgggtgggatcgctcgcgatctcgctcgtggtcgggtac
ggcgcctacctgaccgccatccggttactctag

DBGET integrated database retrieval system