KEGG   Halanaeroarchaeum sulfurireducens HSR2: HLASF_0506Help
Entry
HLASF_0506        CDS       T03927                                 

Gene name
pitA
Definition
(GenBank) putative phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hsu  Halanaeroarchaeum sulfurireducens HSR2
Brite
KEGG Orthology (KO) [BR:hsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HLASF_0506 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 PT-VENN
Motif
Other DBs
NCBI-ProteinID: AKH97005
UniProt: A0A0F7P9Y7
Position
complement(486471..487751)
Genome map
AA seq 426 aa AA seqDB search
MRTERKHVAELLILVGLLVAVFVGYNIGGSSTGVAFGPAVGSRAVRKVTAGALFTVFAFL
GAWTIGRKVITTMSTEIINAAAFTPAASVGVLFFTGLALLISNLYGVPASTSMTAVGAIV
GLGLATGTLNTALMFTILSAWIVAPLIAVFTGVFIGRYLYPHLDAKFAFGRLTNPLIAID
TQGRLPRLSVNDNVAPRDLIGSALVVAIACYMGFSAGASNAANAVAPLVGNGSLDPSPAI
LLAVGAISVGGFTIARRTLATVGNDVTNMPILAALIVSTVGATIITVLSWLGIPASLAVS
TTSCIIGLGWGRASRARTLAEIAKQSPADEPAPQFTTGALKLPPVEGDEGVAASPTVGEL
AEGEIPGPDRQHASGDHVSSIGEKDPEELSAESLFDPAAAARIVTLWAITPTMAVVGSYG
LFSLLA
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaccgaacgcaagcacgtggcagaattactaattctcgtgggattgctggtggcg
gtgttcgtcgggtacaatatcggcgggtcatcaaccggtgttgccttcggtccggcggtc
ggcagccgggccgtcagaaaagtcaccgccggagcactgtttaccgtgttcgcgttcctc
ggagcgtggacgattgggcggaaggtcatcacgacgatgagtaccgaaatcatcaatgca
gcagcctttacacccgcagcgagcgttggcgtcctctttttcaccgggctcgcactcctg
atctcgaacctctatggtgtcccggcgtcaacctcgatgacagccgtcggggcaatcgtc
ggactcggattagcaacggggacgctcaacactgccctgatgtttaccatcctgtcggca
tggatcgtcgctccactgatcgctgtcttcacaggtgtgtttatcggcagatatctgtac
ccgcatctcgacgccaaattcgcatttggtcgcctcacgaacccgttgatcgcaatcgat
acccaggggaggctcccacggctatcggtcaacgataacgtggcacctcgagatttgatc
gggtcggcgcttgtggtggcaattgcctgctacatgggattcagcgctggggcctcgaac
gcggcgaacgcagtcgccccgctcgtcggcaacggttccctcgaccccagcccggcgatt
ctcctcgcggtcggggccatcagcgtgggtggcttcacgattgcccggcggacgctggcg
accgttggcaacgatgttacaaatatgccgattctagcagcgcttatcgtttcgaccgtg
ggtgcgacgatcatcaccgtcctctcgtggctcggaattccagccagtctcgccgtgagt
acgaccagttgcatcattgggctcgggtggggccgtgcaagccgagcccggacgctcgcg
gaaatagccaaacagtctcctgctgatgaacccgctccacagtttacaactggtgcactc
aaactcccgccagttgagggcgacgagggggtcgctgcgagcccgactgtgggcgaactc
gctgaaggcgagattcctggcccggacaggcagcacgcatccggggatcatgtgtctagt
attggcgagaaagacccggaagaattgtccgccgaaagtctgttcgaccccgcagcggca
gctcgcatcgtgacgctctgggccatcacgccgacgatggcggtcgtgggatcctatggc
ttgttttcactcctcgcctaa

DBGET integrated database retrieval system