KEGG   Hymenobacter swuensis: Hsw_1400Help
Entry
Hsw_1400          CDS       T03055                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hsw  Hymenobacter swuensis
Pathway
hsw00020  Citrate cycle (TCA cycle)
hsw00620  Pyruvate metabolism
hsw01100  Metabolic pathways
hsw01110  Biosynthesis of secondary metabolites
hsw01120  Microbial metabolism in diverse environments
hsw01130  Biosynthesis of antibiotics
hsw01200  Carbon metabolism
Module
hsw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hsw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hsw_1400
   00620 Pyruvate metabolism
    Hsw_1400
Enzymes [BR:hsw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Hsw_1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: AHJ96995
UniProt: W8F5I9
Position
complement(1580401..1581921)
Genome map
AA seq 506 aa AA seqDB search
MSTTDSTAPLTADVVLIGAGIMSATLGLMLKELQPDLTIAVFERLDVAAAESSDAWNNAG
TGHSAFCELNYTPEQPDGSIDISKAIKIAEQFEQSKQFWAYLVEKYQVTGVTRFINHIPH
LSFVWGDKNVEFLRKRHAALVQSPLFAGMQFSQDRAEMARWMPLVMDGREPQQPVAATRM
DLGTDVNFGSLTRGMFTLLQEKPGVSFYFHHDVEGLKRREDGSWRVKARDLTTSEKVKIR
APFVFIGAGGGSLPLLIKSEIPEGQGFGGFPVSGQWLKCINPEVIARHHTKVYGKASVGS
PPMSVPHLDTRVINGKQELLFGPYAGFSTKFLKQGSYLDLPLSVKLSNMRPMIIAGLKNM
PLTKYLINQVRQSPEDRLAALREYLPEARGEDWQLETAGQRVQVIKKDAKEGGVLEFGTE
VVAAADGSIAALLGASPGASTAVSIMVGLVQRCFAESARTPAWQAKMREMIPSFGKNLND
EPQLVAQLRAHTSAVLGLNENTPAQQ
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgaccgacagcactgctcctctcaccgccgatgtggtgctgattggagctgga
atcatgagtgcaaccctgggcctgatgctcaaggagttgcaacccgaccttaccatagcc
gtttttgagcggctcgacgtggctgctgccgaaagctccgatgcctggaacaacgctggc
actggccactcagccttttgtgagctgaactatacgcctgaacaacccgacggcagcatc
gacatcagcaaggccatcaaaattgccgagcagtttgaacagtcgaagcagttctgggcc
tatctagtggagaagtaccaggtcacgggcgtaacacgcttcatcaaccacattccgcac
ctgagctttgtgtggggcgataagaacgtggagttcctgcgcaagcgccacgcggccctc
gtgcagtcccccctgtttgccggcatgcagtttagccaggaccgcgccgaaatggcccgc
tggatgccgctggtcatggacggccgcgaaccgcagcagcccgtagccgccacccgcatg
gacttgggcaccgatgttaacttcggctccctcacccggggcatgttcacgctgttgcag
gaaaagcctggcgtttcgttttacttccaccatgatgtggaaggcctcaaacgccgggaa
gacgggagctggcgtgtaaaagcccgcgacctgaccaccagcgaaaaagtaaaaatccgg
gcaccgtttgtgttcattggggccggaggcggctcactgccgctgctcatcaaatcggaa
attccggaaggtcaggggttcggtggcttccccgtgagcggccaatggctcaagtgtatc
aaccccgaagtcattgcccgtcaccataccaaagtgtacggcaaggcatccgtgggctcc
cctcctatgtcggtaccacacttggatacccgcgtcatcaatgggaaacaggaattgctt
tttggcccgtacgccggcttcagcaccaagtttctcaagcagggctcttaccttgatttg
ccactgtcggtgaagctcagcaatatgcggcccatgattattgcgggcctcaagaatatg
cccctcaccaagtacctgatcaaccaagtcagacagtcgccggaagaccggctggcggcc
ctgcgcgaatacctgcccgaagcgcggggcgaagactggcagctggaaacggctggccag
cgcgtgcaggttatcaagaaggacgcgaaggaaggcggtgtgctggaattcggcaccgag
gtggtagccgccgccgatggttccattgcagccctgctgggcgcttcgccgggggcttcc
acggccgtgagcattatggtgggactggtgcagcggtgttttgccgaaagtgcccgcacg
ccggcctggcaggccaaaatgcgcgaaatgattccttctttcggcaaaaacctgaacgat
gagccacaattggtagcgcagctccgcgcccacactagtgccgttttggggctaaacgaa
aatacccccgcgcaacagtag

DBGET integrated database retrieval system