KEGG   Hymenobacter swuensis: Hsw_4234Help
Entry
Hsw_4234          CDS       T03055                                 

Definition
(GenBank) Low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hsw  Hymenobacter swuensis
Brite
KEGG Orthology (KO) [BR:hsw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Hsw_4234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AHJ99829
UniProt: W8F345
Position
complement(4813643..4815049)
Genome map
AA seq 468 aa AA seqDB search
MFGLEPHVLLLLIACLVAACAFEFVNGFHDTANAVATVIYTNTLRPWVAVVWSGFWNFIG
VLTGGIAVAMGIVYLLPVESLVDQNVYHGIAMVGALIIAAIIWNVGTWYYGLPSSSSHAL
IGSILGVGIAYSLLPESNGAAVNWGKAGETMASLLISPIFGFSLTIIMMFLLKRFVANKS
IFKEPHKRKPPPLWIRLILIATCTLVSFFHGSNDGQKGVGLIMLILIGIVPIHFALNSKL
NPLDMRASLTNVEMVMNKVNVNGLSEADSKLLADIRTQTSTLDQIFAGKTDVKQLPETAR
FEIRKAILLLNNRAKKLTSSDKVPLSTADRTTFEDSIKQMRTFTDYAPWEVSFMVALSLG
IGTMVGWKRIVKTIGERIGKEHLTYAQGASSELVAAAMIGVNTQFGLPVSTTHVLSSAIA
GSMVANRGIKNLNPQMIRNIALAWVLTLPVTMTLAGGLFLLFRAIIPS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcttagagcctcatgtgctgctgctgctgattgcctgtctggtagcagcctgc
gcgtttgaatttgtaaacggcttccacgatacggccaacgcggtggctacggtgatttac
accaacacgctgcggccctgggtggccgtggtgtggtcgggcttctggaacttcatcggg
gtgcttacgggcggtattgcggtggccatgggcatcgtgtacctgctgccggtggaaagc
ctcgtagatcagaacgtgtaccacggcattgctatggtgggcgcgcttatcattgcggcc
atcatctggaacgtaggcacctggtattacggcctgccctcgtcgtcgtcgcacgccctc
attgggtccatcttaggcgtgggcattgcctactccctgctgcccgagtcgaacggagca
gccgtgaactggggcaaagccggcgaaaccatggcttctctgctgatcagccccatcttc
ggcttctcgctgaccatcatcatgatgtttctgttgaagcggtttgtggccaacaagtcc
atctttaaagagccccacaagcgcaagccgccacccctctggattcgtctgattctgatt
gccacctgcacgctggtgagcttcttccacggctccaacgacggccagaagggcgtgggc
ctgatcatgctgattctcatcggcatcgtgcccattcactttgccctgaactccaagctg
aacccgctggatatgcgcgcgtcgctgaccaacgtggaaatggtgatgaacaaggtgaac
gtgaacggcctgagcgaagccgacagcaagctgctggccgacatccggacccagacaagc
acactggaccagattttcgccggtaaaaccgacgtgaagcaactgcccgaaacggcccgc
ttcgaaatccgcaaggccattctgttgctgaacaaccgcgccaagaaacttacctccagc
gacaaagtgcccctgagcaccgccgaccgcaccaccttcgaggacagcatcaagcagatg
cgcactttcacggactacgcgccctgggaggtttccttcatggtggccctgtccttgggt
attggtacgatggtgggctggaagcgcatcgtgaaaaccatcggggagcgaatcgggaag
gagcacctgacgtacgcgcagggtgcgtcgtcggaactggtagccgccgccatgattgga
gtgaacacccagttcggcctgcctgtttctaccacccacgtcctgtcgtcggccattgcc
ggcagcatggtggccaaccgcggcatcaagaacctgaacccccagatgatccgcaacatt
gccctggcctgggtactcaccctacccgtgacgatgacgctggccggcggattgttcctg
ctattccgggccatcattccgagctaa

DBGET integrated database retrieval system