KEGG   Hymenobacter swuensis: Hsw_PA0248Help
Entry
Hsw_PA0248        CDS       T03055                                 

Definition
(GenBank) cobyrinic acid a,c-diamide synthase
  KO
K02224  cobyrinic acid a,c-diamide synthase [EC:6.3.5.9 6.3.5.11]
Organism
hsw  Hymenobacter swuensis
Pathway
hsw00860  Porphyrin and chlorophyll metabolism
hsw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hsw_PA0248
Enzymes [BR:hsw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.9  hydrogenobyrinic acid a,c-diamide synthase (glutamine-hydrolysing)
     Hsw_PA0248
    6.3.5.11  cobyrinate a,c-diamide synthase
     Hsw_PA0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 MobB PEP-utilizers
Motif
Other DBs
NCBI-ProteinID: AHJ95581
UniProt: W8EZ14
Position
pHsw1:complement(283431..284786)
Genome map
AA seq 451 aa AA seqDB search
MALPTVSEKPQFLLAAPASGNGKTTLTLGLLRVLARRGLVVQPFKCGPDYLDTHHHTQAA
GRPSLNLDVFMASPAHLHSTYARYTAPADVAVVEGVMGLFDGAVRMQGSAADVAEQLGIP
VILVVNAKAMAYSVAPLLFGFKTFHPGIRLVGAIFNFVNTASHYEFLREACADVGVEALG
YLPNNPAFTIPSRHLGLSIDAELQYETVVEALADALPHTVDVDRLLELTRTAVPTTVPPP
AAPVMAGRRRIAVARDAAFTFTYHQNLQALSRFGEVRYFSPLTDAALPLGTDFLYLPGGY
PELFAEALSANETMRTSIAAYCRQGGATYAECGGLMYLGQHLLDAPGQPFAMAGVLPCST
TMQDAKLTLGYRVVHWDGLTVKGHEFHYSRLLDHGLTPEAVEVTNAKGGPVLGQLYRQGN
VWASYLHLYWGEDAGFIARLLEASAPVLPPQ
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtggctttacctaccgtttccgaaaagccccaattcctgctcgccgccccggccagcggc
aacggtaagaccaccctgacgctggggctgctgcgggtgctggcccggcgcgggctggtg
gtgcagcccttcaagtgcggccccgattacctcgacacccaccaccacacccaggccgcc
ggccgcccgagtctcaacctcgacgtgttcatggcctcgccggcccacctgcacagcacc
tacgcccgctacaccgcccccgccgacgtggccgtggtggaaggcgtgatgggcctcttc
gatggggccgtgcggatgcagggtagcgccgccgacgtggccgagcagctgggtattccg
gtgattctggtggtcaatgccaaagccatggcgtactcggtggccccgctgctgttcggg
ttcaagacgtttcaccccggtatccggctggtgggggctattttcaactttgtcaatacg
gcctcgcactacgagtttctgcgcgaagcctgcgccgacgtgggggtggaagccttgggc
tacctgcccaataatccggcctttaccatcccgtcgcgccacctgggcctctccatcgac
gccgagctgcaatacgaaaccgtggtggaagccctggccgacgccctgccccacaccgtg
gacgtggaccggctgctggagctcacgcgcaccgccgtgccaaccaccgtgccgccgcca
gccgcgccggtaatggctggccgccgccgcattgccgtggcccgcgacgcggcgtttacg
ttcacttatcatcagaatttgcaggcgttgtcccggtttggcgaggttcggtacttcagc
cccctgaccgatgccgcgctgccgctgggcaccgattttctgtacttgcccggcgggtat
ccggagctgtttgccgaagccctgagcgccaacgaaaccatgcggaccagcattgccgcg
tactgccggcaaggcggggcaacctacgccgagtgcggggggctgatgtacctgggccag
cacctcctggatgcgccgggccagccgtttgccatggcgggcgtgctgccgtgctccacc
accatgcaggacgccaagctgaccctcggctaccgcgtggtgcactgggacgggctaaca
gtcaaaggccacgagttccactattcgcgcctgctcgaccacggcctgaccccagaagcc
gtggaggtcaccaacgccaagggcgggcccgttttggggcaactgtaccgccagggcaac
gtgtgggcctcctacctgcacctgtactggggcgaagatgccggctttattgcgcgctta
ttggaggcgtcggcgccggtgctgccgccacagtag

DBGET integrated database retrieval system