KEGG   Herbaspirillum seropedicae Z67: ACP92_01180Help
Entry
ACP92_01180       CDS       T04519                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hsz  Herbaspirillum seropedicae Z67
Pathway
hsz00640  Propanoate metabolism
hsz00650  Butanoate metabolism
hsz00900  Terpenoid backbone biosynthesis
hsz01100  Metabolic pathways
hsz01110  Biosynthesis of secondary metabolites
hsz01120  Microbial metabolism in diverse environments
hsz01130  Biosynthesis of antibiotics
hsz01200  Carbon metabolism
hsz01212  Fatty acid metabolism
hsz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACP92_01180
   00630 Glyoxylate and dicarboxylate metabolism
    ACP92_01180
   00640 Propanoate metabolism
    ACP92_01180
   00650 Butanoate metabolism
    ACP92_01180
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACP92_01180
   00072 Synthesis and degradation of ketone bodies
    ACP92_01180
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACP92_01180
   00310 Lysine degradation
    ACP92_01180
   00380 Tryptophan metabolism
    ACP92_01180
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACP92_01180
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACP92_01180
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACP92_01180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsz04147]
    ACP92_01180
Enzymes [BR:hsz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ACP92_01180
Exosome [BR:hsz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACP92_01180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKN63962
UniProt: A2RPY8
Position
244669..245844
Genome map
AA seq 391 aa AA seqDB search
MDDVVIVAAQRTAIGKFGGALSKIAAADLGAQVIKALLAKTGIKPEAISEVILGQVLTAG
LGQNPARQSVIKSGLPDMVPAFVVGKVCGSGLKAVQLAAQAIRCGDAQIVIAGGQENMSA
SPHVLNNSRDGFRMGDAKLTDTMIVDGLWDVYNQYHMGITAENVAKKFEISREEQDAFAA
ASQNKAEAAQKAGKFKDEIVPIEIKGKKETVVFDTDEFVKHGVTAESLATLRPAFDKAGT
VTAGNASGINDGAAAVVVTSAKLAAELGLPVLAKIKAYSSAGLDPSIMGMGPVPASQLTL
KKAGWTPQDLDLMEINEAFAAQAIAVNKQMGWDTSKINVNGGAIALGHPIGASGCRVLVT
LLHEMVRRDAKKGLASLCIGGGMGVALAVER
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgtggtcattgtcgcagcacagagaacggcgatcggcaaattcggcggagcc
ttgtcgaagattgcggcagccgatctgggtgcgcaagtcatcaaggccttgctggccaag
accggcatcaagcccgaagcgatcagcgaagtcatcctcggccaggtgttgacggctggc
ctgggccagaacccggcgcgccagtcggtcatcaagtccggcctgcccgacatggtcccg
gccttcgtggtcggcaaggtctgcggcagcggcctgaaggccgtgcaactggcggcccag
gccatccgttgcggcgacgcccagatcgtcatcgccggcggccaggaaaacatgagcgcc
tccccgcacgtactgaacaactcgcgcgacggtttccgcatgggcgacgccaagctcacc
gacaccatgatcgtcgatggcctgtgggacgtctacaaccagtaccacatgggcattacc
gccgagaacgtcgccaagaagttcgagatcagccgcgaagagcaggacgccttcgccgcc
gcctcgcagaacaaggcagaagccgcccagaaggccggcaagttcaaggatgagatcgtg
cccatcgaaatcaagggcaagaaggaaaccgtggtcttcgacaccgacgagttcgtcaag
cacggtgtcaccgccgaatccctggccacgctgcgcccggccttcgacaaggccggtacg
gtgacggccggcaacgcctcgggcatcaacgatggcgccgccgccgtggtggtgacctcg
gccaagctggctgctgagctgggtctgccggtgctggccaagatcaaggcctactcctcg
gccggcctggaccccagcatcatgggcatgggcccggtgccggcgtcgcagctgaccctg
aagaaggccggctggaccccgcaggacctggacctgatggaaatcaacgaagccttcgcc
gcgcaggccattgcggtgaacaagcagatgggctgggacaccagcaagatcaacgtcaac
ggcggcgccatcgcattgggccaccccatcggcgcctcgggctgccgcgtgctggtgacc
ctgctgcacgagatggtgcgccgtgacgccaagaagggtctggccagcctctgtattggt
ggcggcatgggcgtggcgctggcggtggagcgttga

DBGET integrated database retrieval system