KEGG   Herbaspirillum seropedicae Z67: ACP92_04670Help
Entry
ACP92_04670       CDS       T04519                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
hsz  Herbaspirillum seropedicae Z67
Pathway
hsz00330  Arginine and proline metabolism
hsz00360  Phenylalanine metabolism
hsz00380  Tryptophan metabolism
hsz00627  Aminobenzoate degradation
hsz00643  Styrene degradation
hsz01100  Metabolic pathways
hsz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hsz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ACP92_04670
   00360 Phenylalanine metabolism
    ACP92_04670
   00380 Tryptophan metabolism
    ACP92_04670
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ACP92_04670
   00643 Styrene degradation
    ACP92_04670
Enzymes [BR:hsz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     ACP92_04670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKN64579
Position
complement(1016679..1018193)
Genome map
AA seq 504 aa AA seqDB search
MSIVRPTPEQLKELASSLHIQLTTEQASQYLDLMQASFDAYDVIDGLPDEIPAVKYPRSA
AARPAAKDNPLNAWACKSTVKGAAEGKLAGRTVVLKDNVALAGVPMMNGSSTLEGFVPSY
DATIVTRLLDAGATILGKATCEHFCLSGGSHTSDPAPVHNPRRHGYGSGGSSSGSAALVA
AGEADMAIGGDQGGSIRIPSAFCGTYGMKATHGLVPYTGVMPIEATVDHVGPITANVRDN
ALMLEVIAGADGLDPRQYAPEVQPYTAALDRGVRGLKIGILTEGFALGNMDKRVADKVQE
AIAQLEKLGASVATVSVEEHALAGALWQPIGCEGLTMQMMHGNGMGFNWKGLYDLGLLQH
HAHWREHADDLSATLKLCMFVGQYGLTRYQGRFYAKAQNIARRARAGYDKALADFDLLVM
PTVPIIAQPLPAAGCPLAEYVARAFEMIGNTAPLDITGHPAMSIPCGTVDGLPVGLMLVG
KHYAEATLYQAAAAFEASMDWQQH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtctatcgtccgacccaccccagagcaactcaaggagctcgccagctctctgcacatc
cagctcaccacggagcaggccagtcaatacctggacttgatgcaggcaagcttcgatgcc
tacgatgtcatcgatggcttgcccgatgaaattcccgccgtcaaatatccgcgctcggct
gccgcccgaccggcagccaaggacaatccactcaacgcctgggcctgcaaaagcaccgtc
aagggcgccgccgagggcaagctggcgggccgcaccgtggtgctcaaagacaatgtggcc
ctggcaggcgtgccgatgatgaacggctcttccacgctggaaggcttcgtgccgagctat
gacgccaccatcgtgacccgcctgctcgatgccggcgccaccattctgggcaaggcgacc
tgcgagcatttctgcctgtcgggcggcagccatacctccgatcccgcgccggttcacaat
ccgcgccgccatggctatggttccggcggatcctcatcgggcagtgcggcgctggtggcg
gcaggcgaagcggacatggccatcggtggcgaccagggcggctcgatccgcattccctca
gccttctgcggcacctatggcatgaaggccacgcatggcctggttccctataccggcgtc
atgcccatcgaagcgacggtcgaccatgtgggaccgatcaccgccaacgtgcgcgacaac
gccctgatgcttgaggtcatcgccggcgccgacggactcgatccgcgccaatatgcaccc
gaggtgcagccttataccgcagcgctcgatcgtggcgtgcgtggcctgaagatcggcatc
ctcaccgaaggatttgccctgggcaacatggataagcgggtggcagacaaggtgcaggag
gcgattgcccaactggaaaaactgggagcatccgtggctaccgtatcggtcgaggaacat
gcgctggccggtgcgctctggcagcccatcggctgcgaaggcctgaccatgcagatgatg
cacggcaacggcatgggcttcaactggaaggggctctacgaccttggcctcctgcagcac
cacgcccattggcgtgaacatgccgacgatctgtcggccacgctcaagctgtgcatgttc
gtcggccaatacgggctgacccggtatcagggtcgcttctacgccaaggcccagaacatc
gcccgacgcgcacgcgccggctacgacaaggcgctggctgatttcgatctgctggtcatg
cccaccgtccccatcatcgcgcagccattgccggccgcgggctgtcccctggccgagtac
gtcgcgcgcgccttcgagatgattggcaataccgcgccgctggacatcaccggccacccg
gccatgtccattccctgtggcacggtcgacggcttgccggtgggattgatgctggtcggc
aaacactacgccgaagccacgctctaccaggcagcggcggccttcgaggccagcatggat
tggcagcagcactga

DBGET integrated database retrieval system