KEGG   Herbaspirillum seropedicae Z67: ACP92_10750Help
Entry
ACP92_10750       CDS       T04519                                 

Definition
(GenBank) chemotaxis protein CheY
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
hsz  Herbaspirillum seropedicae Z67
Pathway
hsz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:hsz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACP92_10750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:hsz02022]
    ACP92_10750
Two-component system [BR:hsz02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   ACP92_10750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AKN65675
Position
complement(2419245..2420006)
Genome map
AA seq 253 aa AA seqDB search
MNTTNGNNSNTTTSANQFKVLVVDDDIRLRDLLRRYLTEQGFNVVTAENAQAMNKLWIRE
RYDLLVLDLMLPGEDGLAICRRLRGAGDQTPIIMLTAKGEDVDRIIGLEMGADDYLPKPF
NPRELVARINAVLRRKGPDELPGAPSETPETFEFGDFILDLGTRTLKKNGDTISLTTGEF
SVLKVFARNARQPLSREKLMEMARGREYEVFDRSLDVQISRLRKLIEPDPANPLYIQTVW
GLGYVFIPEGKPR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgaccaacggcaacaatagtaatacgacaacatccgccaatcaattcaaagtg
ttggtggtggacgacgacatccgtctgcgcgacctgctgcgccgctatctgaccgagcag
ggtttcaacgtggtcacggcggaaaacgcccaggccatgaacaagctctggatccgcgag
cgctacgacctgctggtgctggacctgatgctgcccggcgaagacgggctggcgatctgc
cgccgcctgcggggcgcgggcgaccagacgcccatcatcatgctcaccgccaagggcgag
gatgtggatcgcatcatcggcctggaaatgggcgcggacgattacctgcccaaacccttc
aatccgcgtgaactggtggcccgcatcaatgcggtcttgcgccgcaagggaccggacgaa
ctgccgggcgcgccgtcggaaacgccggaaaccttcgagttcggcgatttcatcctggac
ttgggcacccgcacgctgaagaagaacggcgacaccatttccctgacgaccggcgaattc
tcggtcctcaaggtatttgcccgcaatgcccgccaaccgctgtcgcgggaaaagctgatg
gaaatggcgcgcggtcgcgaatatgaagtcttcgaccgcagcctggacgtgcagatctcg
cgcctgcgcaagctgatcgagcccgatccggccaatccgctgtacatccagaccgtctgg
ggcctgggctatgtcttcattcccgaagggaaaccgcgctga

DBGET integrated database retrieval system