KEGG   Herbaspirillum seropedicae Z67: ACP92_15390Help
Entry
ACP92_15390       CDS       T04519                                 

Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
hsz  Herbaspirillum seropedicae Z67
Pathway
hsz00280  Valine, leucine and isoleucine degradation
hsz00410  beta-Alanine metabolism
hsz00562  Inositol phosphate metabolism
hsz00640  Propanoate metabolism
hsz01100  Metabolic pathways
hsz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ACP92_15390
   00562 Inositol phosphate metabolism
    ACP92_15390
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACP92_15390
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ACP92_15390
Enzymes [BR:hsz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     ACP92_15390
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     ACP92_15390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKN66483
Position
complement(3524512..3526020)
Genome map
AA seq 502 aa AA seqDB search
MSQANIPNVPLYLNGEKVQSTSKEWRDVLNPATQEVVARVPFATKEEVDRAVANAKETFK
TWRNTSLAQRMRIMLKFQQLLRENIAPLAELITREHGKTLPDAEGEVMRGLEVVEHACSI
TSLQLGELAENVAGGVDVYTLYQPLGVGAGITAFNFPVMLPCFMFPIAVACGNTFVLKPS
EQDPTSSLFLVELANQAGLPPGVLNVVHGGPDVANMICDHPDIKAVSFIGSTHVGTHIYR
RASEAGKRAQCMMGAKNHCIVLPDAPKDQAINNLLGAAFGAAGQRCMANSVVVLVGQTRE
WIPEIVERSKAMKVGPGTDRKADVGPLVSKAAKERVERLIASGVEQGAKLLLDGRNCKVA
GSENGNFVGPTVFTGVKPEMDIYTQEIFGPAMCIVELDTLDEAIAFINANPNGNGTSIFT
SSGYAARKFQNEIDVGQVGINVPIPVPVAYFSFTGSRASKLGDLGPNGKQAVTFWTQTKT
VTARWYAPDEEAGQVNTTITLK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagccaacatccccaacgttcccctgtacctcaacggtgaaaaggtacagtcc
acttccaaggagtggcgcgacgtattgaacccggccacccaggaagtggtggcgcgcgtg
cccttcgcgaccaaggaagaagtcgaccgggccgtggccaacgccaaggagaccttcaag
acctggcgcaatacctcgttggcccagcgcatgcgcatcatgctcaagttccagcaactg
ctgcgcgagaacatcgccccgctggccgaactgatcacccgcgagcacggcaagacgctg
ccggatgccgaaggcgaagtcatgcgcggcctggaagtggtggagcacgcctgctcgatc
acctcgctgcaactgggcgagctggccgagaacgtggccggcggcgtggacgtctatacg
ctctaccagccgctgggcgtgggggcgggcatcaccgccttcaacttccccgtgatgctg
ccttgcttcatgttccccattgcggtggcctgtggcaataccttcgtgttgaagccctcc
gagcaggatccgacttcctcgctgttcctggtcgaactggccaaccaggccggtctgccg
ccgggcgtcctgaacgtggtgcatggcggcccggacgtggccaacatgatctgcgaccat
cccgatatcaaggcggtctccttcatcggttccacccacgtcggcacccatatctaccgc
cgcgccagcgaggccggcaagcgcgcccagtgcatgatgggcgccaagaaccactgcatc
gtgctgcccgatgcacccaaggaccaggccatcaacaacctgctgggcgcagccttcggt
gcggccggacagcgctgcatggccaattcggtggtggtgctggtgggccagacgcgtgaa
tggattcccgagatcgtcgaacgctccaaggccatgaaggtcggccccggcacggaccgc
aaggccgatgtcggtccgctggtctccaaggcggccaaggaacgtgtggaacgcctgatc
gccagcggcgtggagcagggcgccaagctgctgctggatggccgcaactgcaaggtggcc
ggcagcgagaacggcaacttcgtggggccgaccgtcttcacgggcgtcaagcccgagatg
gacatctacacccaggaaatcttcggcccggccatgtgcatcgtcgaactggacacgctg
gatgaagccattgccttcatcaacgccaaccccaacggcaatggcacgtccatcttcacc
agctcgggctatgcggcgcgcaagttccagaacgagatcgatgtcggccaggtcggcatc
aacgtgccgattccggtccccgtggcttacttcagcttcaccggttcgcgtgcgtccaag
ctgggcgacctcggccccaacggcaagcaggccgtgaccttctggacccagaccaagacc
gtcaccgcacgctggtatgcgcccgatgaagaagccggccaggtcaacaccaccatcacc
ctgaagtaa

DBGET integrated database retrieval system