KEGG   Herbaspirillum seropedicae Z67: ACP92_15470Help
Entry
ACP92_15470       CDS       T04519                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hsz  Herbaspirillum seropedicae Z67
Pathway
hsz00450  Selenocompound metabolism
hsz00970  Aminoacyl-tRNA biosynthesis
hsz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ACP92_15470
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ACP92_15470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsz01007]
    ACP92_15470
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsz03016]
    ACP92_15470
Enzymes [BR:hsz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ACP92_15470
Amino acid related enzymes [BR:hsz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ACP92_15470
Transfer RNA biogenesis [BR:hsz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ACP92_15470
 Prokaryotic type
   Other AARSs
    ACP92_15470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1f Anticodon_1 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AKN66493
Position
3538582..3540654
Genome map
AA seq 690 aa AA seqDB search
MSTSAPRQLFVTTALPYANGAFHIGHIMEYIQADIWVRFQRMQGNEVHFVGADDAHGAPI
MIAAEKAGITPQQFVANIAAGRKQYLDGFHIAFDNWSSTDSPENHELSQEIYRALRDEAK
LISTKTIDQFYDPVKNMFLPDRYIKGECPKCGTKDQYGDSCENCSAVYSPTDLKNPYSTL
SGATPVMKSSEHFFFKLSDPKCVAFLREWALDSNRLQPEVANKAKEWLDGEGGLGDWDIS
RDAPYFGIEIPDAPGKYFYVWLDAPIGYLASLKNYFAKTGRDFDAFMADDKTEQYHFIGK
DITYFHTLFWPAMLKFAGRKTPNNVFAHGFITVSGEKMSKSRGTGISPLRYLDIGMNPEW
LRYYIAAKLNAKVEDVDFNPDDFVARVNADLIGKYVNIASRAAGFIAKRFEGRVSTQWAT
ADDAFLAKLRGVADEIRSLYEQREYGKALRLVMEQADAINAYVDANKPWELAKDSARDAQ
LHEVCSRLLEAFRILTVYLKPVLPQLAAQVEAFLQVQPFQWGDVAMPLADGHVIHAYSHL
MQRVDPKMLDALFEAPEAPAAAASEAAAAESAIEDLAPEITIDDFAKVDLRIAKIVNCEA
VEGSTKLLRLTLDAGEGRTRNVFSGIASAYKPEELVGKLTLMVANLAPRKMKFGLSEGMV
LAASAKDEKSHPGIYILNPWPGAEPGMRVR
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttccgcacctcgccaactcttcgtcacgaccgcactcccctacgccaacggc
gctttccacatcggccacatcatggaatacatccaggccgatatctgggtccggttccag
cgaatgcagggcaatgaggtgcatttcgtgggcgcagacgatgcccacggcgcgcccatc
atgatcgccgccgaaaaggccggcatcacgccgcagcagttcgtggccaacatcgccgcg
ggccgcaagcaatacctggacggcttccatatcgccttcgacaactggagctccaccgac
agcccggagaaccacgaactgtcgcaagagatctaccgcgccctgcgcgatgaagccaag
ctgatctccaccaagaccatcgaccagttctatgatccggtgaagaacatgttcctgccg
gaccgctacatcaagggcgaatgccccaagtgcggcaccaaggaccaatacggcgactcc
tgcgagaactgcagtgcggtctactcgcccaccgacctgaagaatccgtactcgaccctg
tcgggcgccacgcccgtgatgaagtcttccgagcacttcttcttcaagctgtcggacccg
aagtgcgtagccttcctgcgcgaatgggcgctggacagcaaccgcctgcaaccggaagtg
gccaacaaggccaaggaatggctggatggcgaaggcggcctgggcgactgggacatcagc
cgcgacgccccctacttcggcatcgagatccccgacgcaccgggcaagtacttctacgtc
tggctggacgcgcccatcggctacctggcctcgctgaagaactacttcgccaagaccggg
cgcgacttcgacgccttcatggccgatgacaagaccgagcagtaccacttcatcggcaag
gacatcacctacttccacaccctgttctggcccgccatgctcaagttcgccggtcgcaag
acgcccaacaacgtcttcgcccacggcttcatcacggtcagcggcgagaagatgtccaag
tcgcgcggcaccggcatctcgccgctgcgctacctggacatcggcatgaacccggaatgg
ctgcgctactacatcgccgccaagttgaacgccaaggtcgaagacgtggacttcaacccg
gacgacttcgtcgcccgcgtcaatgccgacctgatcggcaagtacgtcaacatcgccagc
cgcgccgccggcttcatcgccaagcgcttcgaaggccgcgtctccacccagtgggccacc
gctgacgacgccttcctggccaagctgcgcggcgtggccgacgagatccgcagcctctac
gagcagcgtgagtatggcaaggccttgcgcctggtgatggaacaggccgacgccatcaac
gcctacgtggacgccaacaagccctgggaactggccaaggacagcgcgcgcgatgcgcaa
ctgcacgaagtctgcagccgcctcttggaagccttccgcatcctgaccgtctacctcaag
ccggtgctgccgcaactggctgcccaggtggaagccttcctccaggtccagcccttccag
tggggcgatgtggccatgccgctggccgatggccacgtcatccatgcctattcccacctg
atgcagcgcgtcgatccgaagatgctcgatgccctgttcgaagcgccggaagcgcctgcc
gctgcggcctccgaagcagccgccgcagaaagcgccatcgaagacctggccccggaaatc
accatcgacgacttcgccaaggtcgatctgcgcatcgccaagatcgtcaactgcgaggcc
gtggaaggctccaccaagctgctgcgcctgaccctggacgcgggcgaaggccgtacccgc
aatgtcttctccggcattgcctcggcctacaagccggaagagctggtgggcaagctgacc
ctgatggtggccaacctggcgccgcgcaagatgaagttcggcctctccgaaggcatggtg
ctggcggcttcggccaaggacgagaagtcccatcctggcatctacatcctcaatccgtgg
ccgggcgccgagccgggcatgcgcgtgcgctaa

DBGET integrated database retrieval system