KEGG   Herbaspirillum seropedicae Z67: ACP92_19400Help
Entry
ACP92_19400       CDS       T04519                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
hsz  Herbaspirillum seropedicae Z67
Brite
KEGG Orthology (KO) [BR:hsz00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    ACP92_19400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AKN67207
Position
complement(4447609..4447983)
Genome map
AA seq 124 aa AA seqDB search
MAAYEFTVTVKTQYLEEQSDPSRSHYVFAYAITIVNTGTVPAQLISRHWVITDANNHVEE
VRGLGVVGHQPFLQPGEQFEYTSGTSLKTPQGSMHGEYFCVAEDGEQFDVRIPEFVLSLP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgtatgagttcacggtgacggtcaagacccagtacctggaggagcaatccgat
ccatcgcgttcgcattacgtgttcgcctatgcgatcaccatcgtcaataccggcaccgtg
ccggcgcagctcatttcgcgccactgggtcatcaccgacgccaacaaccacgtcgaggaa
gtgcgcgggctgggcgtggtgggacatcaacccttcctgcagccgggcgaacagttcgaa
tacaccagcggcacctcgctcaagacgccccagggcagcatgcacggcgaatacttctgc
gtggccgaggatggcgaacagttcgacgtgcgcattcccgaattcgtcctctcgctgccg
cgcaccctgcactga

DBGET integrated database retrieval system