KEGG   Haloarcula taiwanensis: BVU17_05610Help
Entry
BVU17_05610       CDS       T05292                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
hta  Haloarcula taiwanensis
Pathway
hta00627  Aminobenzoate degradation
hta01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hta00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BVU17_05610
Enzymes [BR:hta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     BVU17_05610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 PGP_phosphatase Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AUG47027
UniProt: A0A2H4ZX58
Position
I:complement(1071648..1072442)
Genome map
AA seq 264 aa AA seqDB search
MTVAGVIIDLDGTVYHGNTLLPGAASAIDTFRQRGLGICFFSNNPIHDGSEYVERLQGLG
VDAREGEACSSGVVTREYLNGSHAGDDVFVIGSEPLRSMVTGTEARLSEDPAETDVLLAS
WTDGFHYHDMVDALRAVDDDTVFLGTDPDRTFPGEDGDPVPGSGAIINAVAGVIERDPDR
ILGKPSEIAVQAALERLDCGPADCLVVGDRLETDIAMGERNGMTTVLVRTGVSNERSLER
SAVTPDYVIDSLAEIEDVLVALDA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacagttgcgggggttatcatcgacctcgatggaacggtgtaccacggaaacacgctg
ttgccgggcgcggcgtcggcaatcgatacgttcaggcagcgtggtctgggaatctgcttc
ttctcgaacaaccccatccacgacgggagcgagtatgtcgagcggttgcagggattgggt
gtcgacgcccgcgagggcgaggcctgttcctccggcgtcgtcacccgcgagtacctcaac
ggatctcatgcgggtgacgacgtgttcgtcatcgggagtgagccgctccgcagcatggtc
acggggacagaggcacggctgtccgaagacccagccgagacagacgtgttactggcctct
tggacggacggcttccactaccacgacatggtcgacgcgctccgggccgtcgacgacgac
accgtcttcctcggaaccgacccggaccgaacgttccctggcgaagacggcgacccggtt
ccgggctccggagcgataatcaacgccgtcgctggcgtcatcgaacgggacccggaccgg
atactcgggaagccttcggagattgccgtccaggcggccctggaacggttggactgtggg
ccagcggactgtctggtcgttggcgaccggctggagacggacatcgcaatgggcgaacgg
aacggaatgacgaccgttcttgtccggaccggcgtgtccaacgagcggtcgctggaacgg
agtgctgtgacacctgactatgtcatcgactcgctggcggagattgaggacgtgctggtg
gcgctcgacgcatga

DBGET integrated database retrieval system