KEGG   Hydrogenobacter thermophilus: Hydth_0353Help
Entry
Hydth_0353        CDS       T02106                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
hte  Hydrogenobacter thermophilus
Pathway
hte00340  Histidine metabolism
hte01100  Metabolic pathways
hte01110  Biosynthesis of secondary metabolites
hte01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Hydth_0353
Enzymes [BR:hte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Hydth_0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh DUF4047
Motif
Other DBs
NCBI-ProteinID: ADO44756
UniProt: D3DG69
Position
359052..360332
Genome map
AA seq 426 aa AA seqDB search
MKVEDLRNTAWRFNERLRYIAKRGEVLEEEYEPIVREIIKRVKEEGDKAITYYTEKFDGV
KLTPDTMEVPYEELENAYNEIEEDVRSALEIAYERIRRFHELQREKAFFMEESGTLLGMK
VVPLERVGVYVPGGKAAYPSTVLMNVVPALVAGVEEIIMVSPKPNKYTLAAAFISGVSRV
YQIGGAQAIAGLAYGTEMIPKVDKIVGPGNIYVAIAKKLLFGVVDIDMIAGPSEILIISD
GSCEPSWIATDLLSQAEHDEMAGAFMITTDEKHALRVKEELERLMEDFPRKEIAKKSIER
FGTIFLVEDMFKACEVANYIAPEHLEVLTEDPFSLLPYIKHAGAIFLGRYSTEALGDYIL
GPNHTLPTGGTARFFSPLGVYDFIKRSSVLFVSKEGFERLAEPTESIAKAEGLFAHFTSV
RIRRET
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagaggaccttagaaacactgcatggaggttcaacgaaagactgagatacatt
gccaagagaggggaagtcctggaggaagagtatgagcctattgtcagggaaataataaag
agggtcaaagaggagggtgataaagctataacttattacacagaaaagtttgacggtgtg
aagctcacgccggatactatggaagtgccatatgaggagcttgagaatgcttacaacgag
atagaggaagatgtaaggtcagctcttgagatagcctacgagaggataagaaggtttcac
gaacttcaaagggaaaaggccttttttatggaagagagtggaacactcttaggtatgaag
gtggtgcctttggagagggtgggtgtttatgtgccgggaggtaaagctgcttacccatcc
acagtgcttatgaatgttgttccggctcttgtggcaggtgttgaggagatcattatggta
tccccaaagcccaacaaatacactcttgctgcagcttttatatctggtgtcagcagggtt
taccaaatagggggtgctcaggcaattgcaggccttgcctacggaactgagatgatacca
aaagttgataagatagtaggtcccggcaatatatatgtagctatagctaagaagctactc
tttggagttgtggacatagatatgatagcgggtccgtcggagatactgataatatctgat
ggctcttgtgaaccttcgtggatagctacggaccttctctctcaggcggaacacgacgag
atggcaggtgcctttatgataactacggatgaaaaacatgccctgcgcgtaaaggaagag
ttggaaagactgatggaagactttccaagaaaagagatagcaaaaaagtccatagagcgc
tttggaaccatatttcttgtggaggacatgtttaaagcgtgtgaagtggctaactatata
gcaccagagcaccttgaagtgcttacagaagaccccttctcccttcttccctacataaag
catgcaggagccatctttttaggaagatacagcacagaagctctgggcgactatatttta
ggtccaaatcacacccttcccaccggtggcacagcaagattcttctcacccttgggagtt
tacgactttataaagagaagctctgtgctttttgtttccaaggaagggtttgaaagactt
gcagagcctacagaaagtatagcaaaggcggagggtctttttgcccattttacatctgta
aggataaggagagagacatga

DBGET integrated database retrieval system