KEGG   Hydrogenobacter thermophilus: Hydth_1192Help
Entry
Hydth_1192        CDS       T02106                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
hte  Hydrogenobacter thermophilus
Pathway
hte00220  Arginine biosynthesis
hte01100  Metabolic pathways
hte01110  Biosynthesis of secondary metabolites
hte01130  Biosynthesis of antibiotics
hte01230  Biosynthesis of amino acids
Module
hte_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:hte00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Hydth_1192
Enzymes [BR:hte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     Hydth_1192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: ADO45580
UniProt: D3DIK2
Position
complement(1089496..1090407)
Genome map
AA seq 303 aa AA seqDB search
MIRNFVDLWEITPDEGWAILLDAESIKTGRDNQKYLLGKNVGLFFTKPSTRTRVSFEVAV
HQLGGNAIYLAEQSLQVSRGEDLKDTSRTLSRYLDCIVIRTDSHRKLEEYARYSTVPVIN
ALTDMSHPCQVLSDVFTLYETFQEDLRNIKIAYVGDGNNVCNTWLVAAGLFGLNLFVATP
EGYEPSSYYYQAGEDLCKITGGSIYLTTNPVEAVKDAHVVYTDVWVSMNQERDEEKLNLL
KPYQVNQKLLSYARSDVKVMHCLPARKGEEITEDVFEAHADFIFRQAENRLHAQKALLKF
LLV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgataaggaattttgtggatctgtgggagattactcctgacgaaggatgggctattttg
ctggatgcggagagcataaaaactggtagggataatcaaaagtatcttttggggaaaaat
gtggggctttttttcacaaaaccctctacaaggacaagggtatcttttgaggtggcagtc
catcagctgggaggaaatgccatatatcttgcggagcagagcttgcaggtttcaagaggt
gaagacctaaaggatacttcaaggactctttccagatacctggactgtatagtgataaga
acagactcccacagaaagttggaagagtatgctagatactccacggtgccggtgataaac
gctttaacggatatgtcgcatccctgtcaggtgctcagtgatgtttttaccctttatgag
accttccaagaggacttgaggaatataaagatagcttatgtaggtgatggaaacaatgtt
tgcaacacttggcttgtggccgctggtctttttggtcttaacctctttgtggcaactccc
gaaggttatgaacccagcagttattactaccaagccggcgaagacctctgtaagattaca
ggtggaagcatatacttgactaccaatccagtggaagctgtaaaagacgcgcatgtagtt
tatacggatgtttgggtgagtatgaatcaggagagggacgaggagaagctaaacctgtta
aagccttatcaggtaaaccaaaagctgctgtcttatgcaaggagcgatgttaaggtgatg
cactgtcttcctgccagaaagggtgaggagataacggaggatgtttttgaagctcatgcg
gatttcatattcaggcaggcggaaaacagattacatgcacaaaaggcacttttaaagttt
ttgctggtataa

DBGET integrated database retrieval system