KEGG   Hydrogenobacter thermophilus: Hydth_1407Help
Entry
Hydth_1407        CDS       T02106                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hte  Hydrogenobacter thermophilus
Pathway
hte00260  Glycine, serine and threonine metabolism
hte00750  Vitamin B6 metabolism
hte01100  Metabolic pathways
hte01110  Biosynthesis of secondary metabolites
hte01120  Microbial metabolism in diverse environments
hte01230  Biosynthesis of amino acids
Module
hte_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hydth_1407
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hydth_1407
Enzymes [BR:hte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hydth_1407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NinF
Motif
Other DBs
NCBI-ProteinID: ADO45792
UniProt: D3DJ67
Position
1293665..1294897
Genome map
AA seq 410 aa AA seqDB search
MTKVKGLVCRECGKEYPVEPIHVCEFCFGPLEVVYDYQEIKKKLSKEKIENGPKSLWRYI
DLLPVEYPSVGLNAGFTPLKKAENLGRLLGLENLYIKDDSVNHPTLSFKDRVVSVALSKA
KEFGFDTVACASTGNLANSVAAHAAQAGFNCFVFIPANLESQKIFGSLVFKPTVVAVEGN
YDDVNRLCSEIANELNWAFVNINIRPFYAEGSKTLAFEVVEQLGWRAPDAVVAPAASGSL
ITKIWKGLKELYMVGLLDSLKTRVYGAQAEGCSPIAQAWKEGRDFVKPVKPNTIAKSIAI
GNPADGIYALQVTKESSGIWETATDEEIIEGIKLLAETEGIFTETAGGTTIAVLKKLAEK
GYFSPKEIVVAYITGNGYKTMEVLEGHLPESIRIKPTLADFKEKILVKTL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggtgaagggtcttgtttgcagagagtgcggaaaggagtatcccgttgagccc
atacatgtatgtgagttctgctttggaccccttgaggtagtttacgactatcaggagata
aagaagaagcttagtaaagagaagatagaaaatggacccaagagcctttggaggtatata
gaccttttgcccgttgagtatccaagcgttggtttaaacgctggctttacaccactcaaa
aaagccgagaatctgggaaggcttctgggacttgaaaacctctacatcaaagacgactct
gtaaaccatcccactttatccttcaaagatagagtggtttctgttgcgctatctaaagca
aaggagtttggctttgatacggtggcgtgcgcttctaccgggaaccttgccaattctgtg
gctgcgcatgcggcgcaggctggctttaactgttttgtctttattcctgcaaaccttgaa
tcgcagaagatctttggaagtcttgtctttaaacctacagtggtggctgtggaaggcaac
tacgatgatgtaaacaggctgtgttcggagatagccaacgagctaaactgggcttttgtc
aacataaacataagacccttctatgctgaaggttcaaaaacccttgcctttgaagtggta
gagcagttaggatggagagcgccagatgcggttgtggctcctgcagcatctgggtctttg
ataaccaaaatatggaaaggtctcaaggaactctatatggtaggtcttttggatagctta
aagacgagagtgtatggagcgcaggctgaaggttgctctccaatagctcaggcttggaag
gaaggcagggactttgtaaaacccgtaaaacccaatacaatagccaaatcaatagctatt
ggtaatcccgcggatggcatctacgcacttcaggtgacaaaagagagctctggcatatgg
gaaacagcaacggatgaggagatcatagaaggtataaagcttctggcagagacagaaggc
atattcacagagaccgccggtggaactaccattgcagtcctcaaaaaactcgcagagaaa
ggttacttctcaccaaaagagatagtggtggcatacatcacaggtaacggctacaagacc
atggaggtgcttgagggacaccttccagaaagcattagaataaagcccactcttgcagac
tttaaggagaagatacttgtgaagacattatga

DBGET integrated database retrieval system