KEGG   Hydrogenobacter thermophilus: Hydth_1541Help
Entry
Hydth_1541        CDS       T02106                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hte  Hydrogenobacter thermophilus
Pathway
hte00010  Glycolysis / Gluconeogenesis
hte00020  Citrate cycle (TCA cycle)
hte00620  Pyruvate metabolism
hte00633  Nitrotoluene degradation
hte00640  Propanoate metabolism
hte00650  Butanoate metabolism
hte00680  Methane metabolism
hte00720  Carbon fixation pathways in prokaryotes
hte01100  Metabolic pathways
hte01120  Microbial metabolism in diverse environments
hte01130  Biosynthesis of antibiotics
hte01200  Carbon metabolism
Module
hte_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
hte_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hydth_1541
   00020 Citrate cycle (TCA cycle)
    Hydth_1541
   00620 Pyruvate metabolism
    Hydth_1541
   00640 Propanoate metabolism
    Hydth_1541
   00650 Butanoate metabolism
    Hydth_1541
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hydth_1541
   00680 Methane metabolism
    Hydth_1541
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Hydth_1541
Enzymes [BR:hte01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Hydth_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ADO45925
UniProt: D3DJK0
Position
complement(1417509..1418711)
Genome map
AA seq 400 aa AA seqDB search
MQATESILYNRAGQKVVSPDYLLFEAPRTKHFMTGSEAVKEAVKRASVDASVSYPITPQS
EAAHLIGELWVEGYVGVYFRGESEFGVMSEIAGCALAGARTITTTSGPGTLRAMENFPMW
AGTRIPVQLVLMARGVNAPLSIQPDNLEVSFLLDTGCMIWYAETAQDLFDMILAGFVVAE
QPDVHVPVITVVDGFFVSHTRETVMLPPDDIALPPYNPYRAPMPVIDAEVPPGRFLRDPF
VMKSNYISYATHASWQWEVRAAIERSRPYAKHYLRGLIEHFGDPEADLVFVACGTASAQA
KEAVRMLEDEGISARVVKLKTIRPFPIEELREATKGAKYIFVPEFNVVGWLEREVRRYLY
GHSSAEIIGAPRVAGGMTMPAEVIVREVLKLTGKEVKHVI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaacagaaagcattttatataacagggcaggacaaaaagttgtctcaccagat
taccttctctttgaagctccaaggaccaagcactttatgacgggctcggaagcggtaaag
gaggcggtaaaaagggcttccgttgatgcttccgtatcctatcctataactcctcagtcg
gaggctgcacacctcatcggtgagctttgggtagagggctatgtgggcgtttacttcaga
ggtgagtccgagtttggtgtcatgtcggaaattgcagggtgcgctttggctggagcaagg
accataaccaccacctcaggacctggaaccctcagggctatggaaaacttccccatgtgg
gctggtacacgcataccagtccagctggtgcttatggcaagaggcgtaaacgcaccttta
tctatacagccggataacctggaggtctccttcctgctggacacaggttgcatgatatgg
tatgcagaaactgcccaggacctctttgacatgatactggcaggctttgtagtggcggag
cagcctgatgtgcacgtgcctgttataactgtggtggacggattttttgtatctcacacc
agagagacggtaatgctaccaccggatgacatagctctgccaccttacaacccctacagg
gcacctatgcccgtaatagatgcagaagtcccacccggcaggttcctcagagaccccttt
gtcatgaagtccaactacatatcttacgcaacccacgccagttggcagtgggaagtgcgc
gctgccatagaaaggtcaagaccatacgccaaacactatcttagaggtctcatagagcat
ttcggggatccggaggcagacctggtctttgttgcctgcggtacagcatccgcacaagca
aaggaagcggtaagaatgttggaagatgaaggtatttctgcaagggtggtcaagctcaaa
actataagacccttccccattgaggaattaagagaggcaacaaaaggtgccaagtacata
ttcgttcctgagtttaatgtggtaggctggcttgaaagggaagtcagaagatacctatac
ggacactccagcgcagagatcataggtgctcccagagttgctggcggtatgaccatgcct
gcagaagtcatagtgagagaggtgctaaaacttaccggaaaggaggtcaagcatgtcata
taa

DBGET integrated database retrieval system