KEGG   Hydrogenobacter thermophilus: HTH_1553Help
Entry
HTH_1553          CDS       T01167                                 

Gene name
porA
Definition
(GenBank) pyruvate:ferredoxin oxidoreductase alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hth  Hydrogenobacter thermophilus
Pathway
hth00010  Glycolysis / Gluconeogenesis
hth00020  Citrate cycle (TCA cycle)
hth00620  Pyruvate metabolism
hth00633  Nitrotoluene degradation
hth00640  Propanoate metabolism
hth00650  Butanoate metabolism
hth00680  Methane metabolism
hth00720  Carbon fixation pathways in prokaryotes
hth01100  Metabolic pathways
hth01120  Microbial metabolism in diverse environments
hth01130  Biosynthesis of antibiotics
hth01200  Carbon metabolism
Module
hth_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
hth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HTH_1553 (porA)
   00020 Citrate cycle (TCA cycle)
    HTH_1553 (porA)
   00620 Pyruvate metabolism
    HTH_1553 (porA)
   00640 Propanoate metabolism
    HTH_1553 (porA)
   00650 Butanoate metabolism
    HTH_1553 (porA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    HTH_1553 (porA)
   00680 Methane metabolism
    HTH_1553 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HTH_1553 (porA)
Enzymes [BR:hth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HTH_1553 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: BAI70002
UniProt: D3DJK0
Position
complement(1417651..1418853)
Genome map
AA seq 400 aa AA seqDB search
MQATESILYNRAGQKVVSPDYLLFEAPRTKHFMTGSEAVKEAVKRASVDASVSYPITPQS
EAAHLIGELWVEGYVGVYFRGESEFGVMSEIAGCALAGARTITTTSGPGTLRAMENFPMW
AGTRIPVQLVLMARGVNAPLSIQPDNLEVSFLLDTGCMIWYAETAQDLFDMILAGFVVAE
QPDVHVPVITVVDGFFVSHTRETVMLPPDDIALPPYNPYRAPMPVIDAEVPPGRFLRDPF
VMKSNYISYATHASWQWEVRAAIERSRPYAKHYLRGLIEHFGDPEADLVFVACGTASAQA
KEAVRMLEDEGISARVVKLKTIRPFPIEELREATKGAKYIFVPEFNVVGWLEREVRRYLY
GHSSAEIIGAPRVAGGMTMPAEVIVREVLKLTGKEVKHVI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaacagaaagcattttatataacagggcaggacaaaaagttgtctcaccagat
taccttctctttgaagctccaaggaccaagcactttatgacgggctcggaagcggtaaag
gaggcggtaaaaagggcttccgttgatgcttccgtatcctatcctataactcctcagtcg
gaggctgcacacctcatcggtgagctttgggtagagggctatgtgggcgtttacttcaga
ggtgagtccgagtttggtgtcatgtcggaaattgcagggtgcgctttggctggagcaagg
accataaccaccacctcaggacctggaaccctcagggctatggaaaacttccccatgtgg
gctggtacacgcataccagtccagctggtgcttatggcaagaggcgtaaacgcaccttta
tctatacagccggataacctggaggtctccttcctgctggacacaggttgcatgatatgg
tatgcagaaactgcccaggacctctttgacatgatactggcaggctttgtagtggcggag
cagcctgatgtgcacgtgcctgttataactgtggtggacggattttttgtatctcacacc
agagagacggtaatgctaccaccggatgacatagctctgccaccttacaacccctacagg
gcacctatgcccgtaatagatgcagaagtcccacccggcaggttcctcagagaccccttt
gtcatgaagtccaactacatatcttacgcaacccacgccagttggcagtgggaagtgcgc
gctgccatagaaaggtcaagaccatacgccaaacactatcttagaggtctcatagagcat
ttcggggatccggaggcagacctggtctttgttgcctgcggtacagcatccgcacaagca
aaggaagcggtaagaatgttggaagatgaaggtatttctgcaagggtggtcaagctcaaa
actataagacccttccccattgaggaattaagagaggcaacaaaaggtgccaagtacata
ttcgttcctgagtttaatgtggtaggctggcttgaaagggaagtcagaagatacctatac
ggacactccagcgcagagatcataggtgctcccagagttgctggcggtatgaccatgcct
gcagaagtcatagtgagagaggtgctaaaacttaccggaaaggaggtcaagcatgtcata
taa

DBGET integrated database retrieval system