KEGG   Halorhabdus tiamatea: HTIA_0259Help
Entry
HTIA_0259         CDS       T02781                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hti  Halorhabdus tiamatea
Pathway
hti00020  Citrate cycle (TCA cycle)
hti00620  Pyruvate metabolism
hti01100  Metabolic pathways
hti01110  Biosynthesis of secondary metabolites
hti01120  Microbial metabolism in diverse environments
hti01130  Biosynthesis of antibiotics
hti01200  Carbon metabolism
Module
hti_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HTIA_0259
   00620 Pyruvate metabolism
    HTIA_0259
Enzymes [BR:hti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     HTIA_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_3 Pyr_redox_2 HI0933_like NAD_binding_8 FAD_binding_2 Thi4
Motif
Other DBs
NCBI-ProteinID: CCQ32409
UniProt: F7PHP3
Position
complement(258358..259701)
Genome map
AA seq 447 aa AA seqDB search
MQGEYDLIIVGGGISGASLLYTVAKFTDVESVALFEKEPEIAAINSHHTNNSQTLHFGDI
ETNYSLEKAEEVKEGAEMVAGYLEDNDPDQEMHAKRSKMALAVGDEEVDRLDSRYHEKGF
GDLFPKLDAIDREEIEAIEPKVVEGREPDTDMLALQTPDGYTVDYGELATDFVREVEGDE
GVDVFTSTEVESVNETDDEFLIETERGWYQSDATVVAAGSHSLQIAKEMGYGEHMSLLPV
AGSFFVAEEGLLNGKVYTLQMAKLPFAAVHGDAEVHDQGLTRFGPTAKVVPALERGRLST
VADFFDVFELSPDSVLSYTNILADRTLLPYVLENLLYDLPAVGKRAFLPHVRKVVPTVEA
SDIERAKGYGGVRPQIVNTETKSLDMGEAKITGNDVIFNVTPSPGASTCLKNAMRDAEQL
TEWLDVDFDEDGFRKATIGNFPRGEIE
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggcgaatacgacctgatcatcgtcggcgggggcatcagcggcgcatcactgctg
tatacagtcgcgaagttcaccgacgtcgagtcggtcgcactcttcgagaaagagcccgag
atcgctgccatcaactcccatcacacgaacaactcccagaccctgcacttcggggacatc
gagaccaactactccctggagaaggccgaggaggtcaaggaaggggccgagatggtcgcc
gggtatctcgaggacaacgaccccgaccaggagatgcacgcaaagcgaagcaagatggcg
ctcgcagtcggtgacgaggaagtcgaccgactcgattcgcgttatcacgagaagggcttc
ggtgacctcttcccgaaactcgacgccatcgaccgcgaggagatcgaagcaatcgaaccg
aaggtcgtcgaagggcgggagccggataccgacatgcttgccctgcagacgcccgacggc
tacacggtcgattacggcgaactcgcgacggatttcgtccgcgaggtcgagggtgacgag
ggcgtcgatgtcttcacgagcacggaagtcgagtcggtcaacgagaccgacgacgagttc
ctgatcgagaccgaacgtggctggtaccagagcgacgcgacggtcgtcgccgccgggtct
cacagcctccagatcgccaaggagatgggctacggtgagcacatgtcgctgctgccggtc
gccgggagcttcttcgtcgccgaggagggcctgctcaacggcaaagtatacacgcttcag
atggcgaaactccccttcgcggcggtccacggcgacgccgaggtccacgatcagggactt
acccggttcggcccgacggcgaaggtcgtgcccgccctggagcgggggcggctctcgacg
gtcgccgatttcttcgacgtgttcgaactctcgccggactcggtgctgagctacacgaac
atcctcgccgatcggaccctgttgccgtacgtcctggagaacctgctctatgacctgcca
gccgtcggcaagcgggccttcctcccccacgtccggaaggtcgtgccgaccgtcgaagcg
agtgacatcgagcgcgcgaagggctacggcggcgtccgcccgcagatcgtcaacacggag
acgaagtctttggacatgggcgaggccaagatcaccggcaacgacgtcatcttcaacgtc
acgccctcacccggggcttcgacctgtctgaagaacgcgatgcgcgacgccgaacaactg
accgagtggctcgacgtcgacttcgacgaagatgggttccggaaggcgacgatcgggaac
ttcccgcgtggtgagatcgaatag

DBGET integrated database retrieval system