KEGG   Halorhabdus tiamatea: HTIA_1497Help
Entry
HTIA_1497         CDS       T02781                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
hti  Halorhabdus tiamatea
Brite
KEGG Orthology (KO) [BR:hti00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HTIA_1497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 MlrC_C
Motif
Other DBs
NCBI-ProteinID: CCQ33624
UniProt: F7PNY2
Position
1484493..1485677
Genome map
AA seq 394 aa AA seqDB search
MGLLVTVATLVVAALAGLFMAWAIGAGSSGSTPFAPAVGANAISVMRAAFVVGLLGLAGA
VLQGANVSETVGSGLILFPDGGGLTPAASILLLLIAGGLVAVGVFSGYPIATAFTVTGAV
VGVGLALGGQPAWGTYQEIVALWVATPFLGGGIAYVTARWLQSGVGGENRIVAALAALVG
VIVSNVEFSVLGEAGEGASIAVAVSRAAGDPAFGPVAVTVVVAGLSAGVLYRSLRTDRAA
AQRQFLLVLGGLVAFSAGGSQVGLAVGPVLPVVDPYDVPLLAVLFGGGLGLLAGSWTGAP
RMIKALSQDYSSLSPRRSIAALIPAFAIAQTAVFFGIPVSFNEIMVSAIVGSGFAAGDAG
ISRAKMGYTVLAWVGSLALALAAGYAGYTLLAMV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggacttctcgtcacggtcgcgacgctcgtcgtcgccgcgctggcggggctgttcatg
gcgtgggcgatcggtgcgggctcgtcgggttcgactccctttgcgcctgccgtcggagcc
aacgccatctcggtgatgcgggcggccttcgtcgtcggcctgctcggactggcgggcgcg
gtgctccagggtgcgaacgtctccgagacggtcgggtccggacttattctgttccctgac
ggcggcggattgactccggccgcttcgatcttgctgctcctcatcgccggcggcctggtc
gccgtcggcgtgttcagcggctacccgatcgcgacggcttttacggtgaccggcgcagtc
gtcggtgtcgggctggcgctggggggccagccggcctggggaacctatcaggagatcgtc
gcgctgtgggtcgcgacgccgtttctgggcggcgggatcgcctacgtcaccgcccggtgg
ctccagagcggggtcggcggcgagaaccgtatcgtcgccgcactggccgctctcgtcggc
gtcatcgtctcgaacgtcgagttcagcgtcctcggggaagccggcgagggggcgtcgatc
gcggtcgccgtctcgcgagcggcaggtgaccccgcgttcggccccgtggcagtgaccgtc
gtcgtggccggtctgtccgccggcgtcctctatcgatccctccggaccgaccgggcggcc
gcccagcgacagttcttgctcgtcctcggcgggttggtcgccttctcggcgggcggaagt
caggtcggcctcgccgtcggccccgtcctcccggtcgtcgatccctacgacgtcccgctg
ctcgcggtgctgttcggcggcgggctcggactgctcgcgggttcctggaccggcgcgccc
cggatgatcaaggcgctgagccaggactactcctcgctgtccccgcggcggtcgatcgcg
gcgctgatccccgcgttcgcgatcgcccagacggctgtcttcttcgggatcccggtctcg
ttcaacgagatcatggtgagtgccatcgttggcagcggcttcgccgccggtgacgcggga
atcagccgggcgaaaatgggctacactgtcctggcgtgggtcggctcgctcgcgctcgcg
ctggccgccggctacgctggctatacgttgctcgcgatggtgtga

DBGET integrated database retrieval system