KEGG   Halorhabdus tiamatea: HTIA_1692Help
Entry
HTIA_1692         CDS       T02781                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
hti  Halorhabdus tiamatea
Pathway
hti00860  Porphyrin and chlorophyll metabolism
hti01100  Metabolic pathways
hti01110  Biosynthesis of secondary metabolites
hti01120  Microbial metabolism in diverse environments
Module
hti_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:hti00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HTIA_1692
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hti01007]
    HTIA_1692
Enzymes [BR:hti01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     HTIA_1692
Amino acid related enzymes [BR:hti01007]
 Aminotransferase (transaminase)
  Class III
   HTIA_1692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Neuregulin
Motif
Other DBs
NCBI-ProteinID: CCQ33819
UniProt: F7PJL6
Position
1696431..1697765
Genome map
AA seq 444 aa AA seqDB search
MNHERSRELYDRALSVAPGGVNSSVRAIQPYPFFVEKGDGGHVIDADGNRYLDFVMGYGP
LLLGHDLPEQVQSAIQQRAAEGPMYGAPTEVEVELAEFVARHVPSVEMVRFVNSGTEATV
SAVRLARGYTGRDKIVIMQGSYHGAQESTLVEGEGTHTSPSSPGIPESFAEHTITVPFND
EEYVEAVFEEHGDEIAAVLTEPILGNHGIVHPVEGYHDTLRDLCDDYGSLLIFDEVITGF
RVGGPQCAQGKFGIEPDVTTFGKIVGGGFPVGAIGGRSEIIEQFTPAGEVFQSGTFSGHP
VTMAAGLETLRYAAENDVWAQVNDLGAQMREGLTDIVANRAPEYTVVGSDSMFKVIFTRD
GASGENHCGSGCRQRESCPSYDACPKNGADVDRAETERWERLFWPAMKEEGVFLTPNQFE
SQFVSAAHTEEDIEEALEAYKEAL
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgagcgctcccgcgagctgtacgatcgcgcgctatcggtcgccccgggcggg
gtcaactcctccgtgcgggcgattcaaccgtatcccttcttcgtcgagaagggcgacggc
ggccacgtcatcgacgccgacggcaaccgctatctggacttcgtgatgggttacgggccg
ctcctgctcggccacgacctgcccgaacaggtccagtcagcgatccagcagcgcgccgcc
gaggggccgatgtacggcgcgcccaccgaggtcgaggtcgaactcgcggagttcgtcgcc
cgccacgtcccgagcgtcgagatggttcggttcgtcaattcggggacggaggcgaccgtc
tcggccgttcgcctcgctcgcgggtacaccggccgggacaagatcgtcatcatgcagggc
tcctatcacggcgcgcaggaatccaccctcgtcgagggcgaggggacgcacacgagcccg
tcgagtcccggcattcccgagagcttcgccgagcatacgatcaccgtcccgttcaacgac
gaagaatacgtcgaggccgtcttcgaagaacacggcgacgagattgcggccgtcctgacg
gagccgatcctcggcaaccacggcatcgtccaccccgtcgaggggtaccacgacacgctg
cgggacctctgtgacgactacggctccctcctgattttcgacgaggtgatcaccggcttc
cgggtcggcggtccccagtgcgcccagggcaagttcggcatcgaacccgacgtgaccacg
ttcgggaagatcgtcggcggcgggttcccggtcggtgcgatcggtgggagaagcgagatc
atcgagcagttcacgcccgcgggcgaggtcttccagtcgggcaccttctcgggtcacccg
gtgacgatggccgccggcctggagacgctccggtacgccgccgagaacgacgtctgggcg
caggtgaacgatctgggagcgcaaatgcgcgaggggctgaccgacatcgtcgcgaatcgc
gcccccgagtacaccgtcgtcgggtcggactcgatgttcaaggtgatcttcacccgcgac
ggggcgagcggcgagaaccactgtggatcggggtgtcgccagcgcgagtcctgtccgagc
tacgacgcctgtccgaagaacggggccgacgtggatcgggccgagaccgagcgctgggaa
cggctgttctggccggcgatgaaggaggagggcgtgttcctgacgcccaaccagttcgaa
tcgcagttcgtctcggcggctcacaccgaggaagacatcgaggaagcgttggaagcgtac
aaggaagcgctgtag

DBGET integrated database retrieval system