KEGG   Hydrogenophilus thermoluteolus: HPTL_0839Help
Entry
HPTL_0839         CDS       T05630                                 

Gene name
cbbL
Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
htl  Hydrogenophilus thermoluteolus
Pathway
htl00630  Glyoxylate and dicarboxylate metabolism
htl01100  Metabolic pathways
htl01110  Biosynthesis of secondary metabolites
htl01120  Microbial metabolism in diverse environments
htl01130  Biosynthesis of antibiotics
htl01200  Carbon metabolism
Module
htl_M00165  Reductive pentose phosphate cycle (Calvin cycle)
htl_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:htl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    HPTL_0839 (cbbL)
Enzymes [BR:htl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     HPTL_0839 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BBD77107
UniProt: A0A2Z6DXD4
Position
complement(891853..893277)
Genome map
AA seq 474 aa AA seqDB search
MSQPKRYEAGVKEYRETYWEPTYVPKDSDFLAVFKIVPQPGVPREEAAAAVAAESSTATW
TTVWTDLLTDLYYYKGRAYAIEDVPGDDEAFYAFIAYPMGLFEEGSVVNVFTSLVGNVFG
FKAVRSLRLEDVRIPLWFVTTCPGPPHGIYVERDKLNKYGRPLLGCTIKPKLGLSAKNYG
RAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCQEAIEKAQAETGERKGHYMNVTGPT
MEEIYKRAEFAKEIGTPIIMIDYLTVGWAATQSLSKWCRDNGMLLHVHRAMHAVIDRNPK
HGINFRVLAKIMRLIGGDHLHSGTVVGKLEGDRAATLGWIDLMRDRYVKADRSRGIFFDQ
DWGQMPGMFPVASGGIHVWHMPALVSIFGDDSVLQFGGGTIGHPWGNAAGACANRVALEA
CVKARNEGLPIEKMGREILTEAAKSCPELKVAMETWKEVKFDFDTVDKLDVQHR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacccaaacgttacgaagcgggggtaaaagagtaccgcgaaacctattgggaa
ccgacctacgttcccaaagattccgatttccttgccgtgttcaagatcgtgccgcaaccg
ggcgttccgcgcgaagaggctgcggctgcggtcgctgcggaatcctccaccgccacctgg
accaccgtctggaccgacctgttgaccgacctttactactacaaagggcgcgcctacgcg
atcgaagacgttcctggcgacgacgaagccttctacgcgttcatcgcctacccgatggga
ctcttcgaagagggatcggtggtgaacgtcttcacgtcgctcgtcggcaacgtcttcggc
ttcaaagcggtgcgcagcctgcgccttgaagacgttcggatccccctctggttcgtcacc
acctgccctgggccaccccatggcatctatgtggagcgtgacaaactcaacaaatacggc
cgtccgcttttgggctgcaccatcaaaccgaaactcggcctttcggcgaagaactacggc
cgtgcggtctatgagtgtctgcgcggtggactcgacttcaccaaagacgacgaaaacgtc
aactcgcaacccttcatgcgttggcgcgaccgcttcctcttctgccaggaagcgatcgag
aaggcgcaagcggaaaccggcgagcgcaagggccactacatgaacgtgaccggcccgacg
atggaagagatctacaagcgcgccgaattcgcgaaagagatcggcaccccgatcatcatg
atcgactacctcaccgtcggctgggccgcgacgcaaagcttgtcgaaatggtgccgcgac
aacgggatgttgctccacgtccaccgtgcgatgcacgcggtgatcgaccgcaacccgaaa
cacgggatcaacttccgcgtgctcgcaaaaatcatgcggctcatcggcggcgatcacctc
cactccggtaccgtagtcggcaagctcgaaggtgaccgcgccgcgaccctcggctggatc
gacctgatgcgcgaccgctacgtcaaggccgaccgaagccgcggcatcttcttcgaccaa
gactgggggcagatgccggggatgttcccggtcgcttccggcgggatccacgtctggcac
atgcccgcgctcgtttcgatcttcggtgacgactcggtgctgcaattcggtggtggcacg
atcggccacccgtggggcaacgccgccggtgcgtgcgcgaaccgcgtcgcgctcgaagcg
tgcgtcaaagcccgcaacgaaggcttgccgatcgagaagatggggcgcgagatcctcacc
gaagccgcgaaatcgtgtccggagctcaaggttgcgatggagacctggaaagaggtcaaa
ttcgatttcgacaccgtcgataaactcgacgtgcaacaccgctaa

DBGET integrated database retrieval system