KEGG   Hydrogenophilus thermoluteolus: HPTL_0909Help
Entry
HPTL_0909         CDS       T05630                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
htl  Hydrogenophilus thermoluteolus
Pathway
htl00670  One carbon pool by folate
htl00790  Folate biosynthesis
htl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:htl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HPTL_0909
   00670 One carbon pool by folate
    HPTL_0909
Enzymes [BR:htl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     HPTL_0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: BBD77177
UniProt: A0A2Z6DXK2
Position
complement(979194..979748)
Genome map
AA seq 184 aa AA seqDB search
MSEIVIIAAMGRNGELGYRNALPWHLPDDLKRFKQLTLGAPVVMGRNTWHSLGRPLPGRT
NVVVSRTLARSQTDAAPTEREPESTLPSGVLCFPTLEAALAALAKAPTVFVIGGAQLYAA
ALPFADRLELTEVDAEVSADAFFPPWPKTEFVEVARTRHPADANHPYPFAFVTYRRVQSR
TQST
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatcgtgatcatcgccgcaatggggcgaaatggggaactggggtaccgcaat
gcgcttccgtggcatctgccggacgacctcaaacgcttcaagcagctcacgctgggggcg
ccggtggtgatggggcgcaacacgtggcactctcttgggaggccgctgccggggcgcacc
aatgtggtggtgagtcgaacgcttgcgcgatcgcaaacggacgccgcgcccaccgaaaga
gaaccggaatcgacgcttccctctggggtgctatgctttccaacgctcgaggcggcattg
gcggcattggcgaaggcgcccaccgtgttcgtgatcggcggcgcgcagctctacgccgcg
gcacttccctttgcggaccgcttggagctcaccgaggtcgacgccgaagtctctgccgac
gcgttctttccgccttggcccaaaacggaattcgtcgaagttgcacgcacgcgacacccg
gcggacgcgaaccacccctatccgtttgcgttcgtcacctaccgccgcgttcaatcgcgc
acgcaatcgacgtag

DBGET integrated database retrieval system