KEGG   Hydrogenophilus thermoluteolus: HPTL_1093Help
Entry
HPTL_1093         CDS       T05630                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
htl  Hydrogenophilus thermoluteolus
Pathway
htl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:htl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    HPTL_1093
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:htl03400]
    HPTL_1093
Enzymes [BR:htl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HPTL_1093
DNA repair and recombination proteins [BR:htl03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     HPTL_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 AAA_22 UvrD-helicase UvrD_C AAA_16 AAA_28 NACHT ATPase TrwB_AAD_bind T2SSE SH3_13 AAA PIF1
Motif
Other DBs
NCBI-ProteinID: BBD77357
UniProt: A0A2Z6DY24
Position
1161575..1163422
Genome map
AA seq 615 aa AA seqDB search
MEPQSETTQSEREREETATTILARHLAQTFQAVSSPPAGADRNVVDEAERAGKAVERFVE
ALLEALAEGNTALQLTAETAAWLRQQPWVSDGSRFAPVILTGTLAQFHRYWLAEQTLAAF
FDARVGIGANSQGLRKADIDPAETAPLDPEFRAAADAFALEAEKRTVIARALTLPVALLT
GGPGTGKTTTLAWFLAAALRRHPELRIALAAPTGKAAQRMGEALTHVLPELPLSDAAKAC
LCALTPLTLHRLLGIGRRPEPSYHAQRPLPYDLVVVDEASMVDVLLLAKLVRALPATAQL
LLIGDPNQLASVEAGNVLADLVARYPNCHLPLSRSHRFTAAIGAFADAVIAGNGDAAWQM
LSPADEAVLRSLFASHEFPKDLPPLRLQPTAAELFAAIDRGFQSVLAHLAVAPNGSDFSS
VAAYVRTLFARYRVFRLLSPLRHDRRYGVRALNARIAEHWHRAHRIPFVGTGAGRPILLG
QPITIESNDYSLSLFNGDQGVVFPWLGTLFAWFLDADAPHGVRPVPLAQLPHWESAWALT
VHKAQGSEFDAVLLVLPAETVTVATRELLYTAITRAKRGFVFWGTEDAFRAAVANRTVRV
SGLGGAVVGSGASAR
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgcaaagcgaaacgacccaatcggaacgggaacgcgaagagacggcaaccacg
attttggcgcgccacctcgcccaaaccttccaggctgtttcctctcctcccgctggtgcg
gatcgaaacgtggtcgatgaagcggagcgcgcgggcaaggcggtggaacgcttcgtggag
gcgcttttggaagcccttgccgagggcaataccgctctccagttgactgccgaaacggcc
gcttggttgcggcaacaaccgtgggtttcggacggctcgcgattcgcgcctgtgatcctt
acggggacgcttgcgcagtttcaccgctactggctagcggaacagaccctggccgctttt
ttcgacgcgcgcgttggcattggcgccaattcccaagggttacggaaagcggatatcgac
cctgccgagaccgcgccgctcgatcccgaatttcgtgcagccgccgatgcgttcgcgctc
gaagcggaaaagcgcacggtgatcgcgcgcgcgctcacactgccggtggccctcttgacc
ggagggccgggcaccggcaagacgacgacgctcgcctggttcttggccgcagcgcttcgg
cgtcatcctgagttgcggatcgcgctcgctgcgcccactgggaaagcggcgcaacggatg
ggggaagcattgacgcacgtgttacccgaattgccgctttcggacgctgcgaaagcatgt
ctttgtgcgctcaccccactcacgctgcaccgtctcttgggcatcgggcgcagacccgaa
ccgagctaccacgcgcaacggccactgccttacgacctggtcgtggtcgatgaagcgtcg
atggtcgatgtgctgcttcttgcgaaactggtgcgcgcgcttcccgctaccgcgcagctt
ctgcttattggagaccccaaccaactcgcctccgtggaagccggcaacgtcttggccgat
ctcgtcgcgcgctacccgaattgccacctgcctctttcccgcagccaccgcttcaccgcc
gcgattggggcgtttgcggatgcggtgatcgcgggcaacggtgacgcggcgtggcagatg
ctgtcccctgcggacgaagcggtgttgcgctctcttttcgcgtcgcatgagttccccaaa
gatcttcctccattgcggctccaaccgaccgcagcggaactgttcgcggcgatcgatcgc
ggatttcaaagcgtgttggcccaccttgccgttgcgcccaacggaagcgacttttcgagc
gttgccgcgtacgtgcgcaccctctttgcgcgctaccgtgtctttcggctgctcagtccc
ttacgccacgatcgccgctatggcgtgcgtgccctcaacgcccgaattgccgaacattgg
caccgcgcgcaccgcatcccgttcgtcggtacgggcgcgggaagaccgatcctgcttggg
cagccgatcacgatcgaaagcaacgactacagtctttccctcttcaatggcgaccaaggg
gtggtctttccgtggctagggacgctttttgcctggtttctcgacgccgacgcgccgcac
ggggtgcgccccgtgccgcttgcgcaattgccccattgggagagcgcgtgggcgctcacc
gtacacaaagcgcaagggtcggaattcgacgccgtgttgctcgtcttacctgccgagacc
gtcaccgtagcgacgcgcgaactgctctataccgcgatcacccgggcgaaacgcgggttc
gttttctggggtaccgaggacgcttttcgcgccgcagtcgcgaatcggacggttcgagtc
agtggtttgggtggcgcggtggttggatctggtgcttctgcacgttga

DBGET integrated database retrieval system