KEGG   Hydrogenovibrio thermophilus: EPV75_03335Help
Entry
EPV75_03335       CDS       T05808                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
htr  Hydrogenovibrio thermophilus
Brite
KEGG Orthology (KO) [BR:htr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EPV75_03335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF677 RRT14
Motif
Other DBs
NCBI-ProteinID: QAB14772
UniProt: A0A410H1J8
Position
complement(723069..724640)
Genome map
AA seq 523 aa AA seqDB search
MEFRDINDIEDATSKSRKEMFRFGSALLFIILIMLFSANLQLGTGTVSVELVIAAMIGGY
MAMNIGANDVANNVGPAVGSKALTLTGAIIIAAVFESAGALIAGGDVISTIKKGIIDPAL
IENGDTFVWLMIAALLSGAIWLNLATAMGAPVSTTHSIVGGVLGAGIAATGWEIANWDKM
GAIAASWIISPVIGGLIAAMFLLWIKRSITYQDDMLAAAKRTVPILISVMAWAFSTYLIL
KGLKKIWHADFLTASLVGLAIAFMVYLSVRPMIARQANGLKSSKASVNALFTIPLIFAAA
LLSFAHGANDVANAVGPLAAINDAVQSHQVSTKAEIPLWVMLIGAIGISLGLLLFGPKLI
KTVGSEITELDQMRAFSIAMAAAITVIIASQLGLPVSSTHIAVGGIFGVGFLREYLKRNY
AKTLQQIRDHHEGANQAEIEQYIERFGKASIQEKKIMLAELKQHKAEVELTKKERKSLNK
VYQKELVKRSAFLKIVAAWVITVPVSGILAAMIYFTIRGMMLP
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggaatttcgggacattaatgacatcgaagacgccaccagcaaaagtcggaaggaaatg
ttccgcttcggatcggccctgctcttcattatcctcatcatgcttttctccgccaatttg
caactgggcaccggaacggtcagtgtcgaattggtcattgccgccatgatcggcggttac
atggcgatgaacatcggcgccaatgacgtggccaacaacgttggccccgccgtcggctcg
aaagccttaaccttgaccggcgccatcatcatcgccgccgtcttcgaatccgccggggcc
ttgattgccggtggcgacgtcatcagcaccattaaaaaaggcattatcgaccccgctctg
attgagaacggcgatacctttgtctggctgatgatcgccgccctcctgtccggagcgatt
tggctgaacctggccacggccatgggcgcgccggtgtccaccacccactccattgtgggc
ggcgttctcggcgccggcatcgccgccaccggttgggaaatcgccaactgggacaaaatg
ggcgccattgccgccagctggattatctcaccggtcatcggggggttgatcgcggccatg
ttcctgctctggatcaaacgcagcatcacctatcaggacgacatgctcgccgcggcaaaa
aggacggtgccgattctgatttccgtcatggcctgggctttctcgacctatttgattctg
aaaggcctgaaaaaaatctggcacgcggactttttaaccgcgtcactggtcggtctcgcc
atcgccttcatggtgtacttaagcgtccgcccgatgattgcccgccaagccaatggcttg
aaaagcagcaaagccagtgtcaacgctcttttcaccattccgttgattttcgccgccgcg
ctattgagcttcgcgcacggtgccaatgacgtcgccaacgccgtcgggcctttggctgcc
attaacgatgcggtgcagagccatcaggtctccaccaaagctgaaattccattgtgggtc
atgttgattggtgccatcggcatcagtttagggctactgttgttcgggccgaaactgatt
aaaaccgtcggttccgaaatcaccgaactggatcaaatgcgtgccttctcgattgcgatg
gccgcggccattaccgtcatcatcgcgtctcagctgggcttgccggtcagttccactcac
attgccgtgggcgggattttcggtgtcggcttcctgcgtgaatacctgaagcgcaactac
gccaaaaccctgcagcagattcgtgaccaccacgaaggcgccaatcaggcggaaatcgag
caatacatcgagcgtttcggaaaagccagcattcaggagaagaaaatcatgctggcggaa
ctaaagcagcataaagcggaagtggaattgaccaagaaagaacgtaaatccttgaataag
gtgtatcagaaagagctggtcaaacgttcggccttcttgaaaatcgtcgccgcgtgggtc
atcaccgtcccggtttccggcattctggcggcgatgatttacttcacgatccgcggtatg
atgctgccataa

DBGET integrated database retrieval system