KEGG   Hydrogenovibrio thermophilus: EPV75_08965Help
Entry
EPV75_08965       CDS       T05808                                 

Gene name
rfbG
Definition
(GenBank) CDP-glucose 4,6-dehydratase
  KO
K01709  CDP-glucose 4,6-dehydratase [EC:4.2.1.45]
Organism
htr  Hydrogenovibrio thermophilus
Pathway
htr00520  Amino sugar and nucleotide sugar metabolism
htr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:htr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EPV75_08965 (rfbG)
Enzymes [BR:htr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.45  CDP-glucose 4,6-dehydratase
     EPV75_08965 (rfbG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 3Beta_HSD NAD_binding_4 RmlD_sub_bind Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: QAB15791
UniProt: A0A410H4G4
Position
complement(1913355..1914425)
Genome map
AA seq 356 aa AA seqDB search
MIDSGFWSGKRVYLTGHTGFKGSWLALWLTEMGAVVKGYALTPPTKPNLFEEAKVAEKIE
SQIGDIRDFEALKVSLSEFNPDILIHMAAQPLVRLSYKEPLETYDTNVMGTAKVLEAARI
CSNLKAIVSVTTDKCYENKEWVWGYREDEPMGGFDPYSSSKGCAELVTSAYRRSFMQEQG
IGLASARAGNVIGGGDWAGDRLVPDILRAFEKNQPVVIRNPASTRPWQHVLEPLSGYLVL
AQHLYQNPKDFAEGWNFGPYEDDAKPVDWILNHMVANWPGASWELDKNAHPHEAGYLKLD
VSKAKARLKWHPTWRLEQTLAKIIKWHQAWLNNADIQQVCLEEINEFMRDFNNANH
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgattgattctggtttttggagcgggaagcgggtttatctaactggccatacggggttt
aaaggtagctggttagcactttggttgaccgaaatgggtgctgtcgtgaagggttatgcc
ctaactccaccgaccaaacctaacctgtttgaagaagctaaagttgctgaaaaaattgaa
tcgcagattggtgatattcgcgattttgaagctttaaaagtaagcctgtctgaatttaac
ccagatattctgattcatatggctgcacaacctttagtgcgcttgtcctataaagaacct
ttagaaacttatgacactaatgtcatgggaacggctaaagtgcttgaagcggcgagaatc
tgttcaaatttaaaagcaattgtcagtgttactactgataagtgttatgaaaacaaagaa
tgggtctgggggtatcgagaagatgaaccgatgggagggtttgacccttactccagttca
aaaggctgtgctgagttggtgacttcagcctatcgtcggtcttttatgcaagaacaaggt
attggtttggcttctgccagagccggtaatgtgattggtggtggagactgggcgggtgat
cgattggttccagatattttacgtgcgtttgaaaaaaatcagccagttgttattcgcaat
cccgcttcaacacgcccttggcaacacgtacttgagccgctttccggttatttggtttta
gcccaacatctataccaaaacccaaaggattttgcagaaggatggaacttcggcccttat
gaagacgacgctaaacctgtggattggattttaaatcacatggtcgctaactggccgggg
gcaagttgggaactggataaaaacgcccatcctcatgaagcgggttatttaaagttggat
gtctctaaagccaaagcgaggcttaaatggcaccccacttggcgtttagagcaaacactt
gccaaaattattaaatggcaccaggcctggctaaataacgcggatatacaacaagtgtgt
ctggaagaaattaatgaatttatgagagattttaacaatgcaaaccactga

DBGET integrated database retrieval system