KEGG   Haloterrigena turkmenica: Htur_0934Help
Entry
Htur_0934         CDS       T01154                                 

Definition
(GenBank) hypothetical protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
htu  Haloterrigena turkmenica
Pathway
htu00020  Citrate cycle (TCA cycle)
htu00190  Oxidative phosphorylation
htu00650  Butanoate metabolism
htu00720  Carbon fixation pathways in prokaryotes
htu01100  Metabolic pathways
htu01110  Biosynthesis of secondary metabolites
htu01120  Microbial metabolism in diverse environments
htu01130  Biosynthesis of antibiotics
htu01200  Carbon metabolism
Module
htu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
htu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
htu_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Htur_0934
   00650 Butanoate metabolism
    Htur_0934
  Energy metabolism
   00190 Oxidative phosphorylation
    Htur_0934
   00720 Carbon fixation pathways in prokaryotes
    Htur_0934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CCB2_CCB4
Motif
Other DBs
NCBI-ProteinID: ADB59828
UniProt: D2RXZ4
Position
959872..960237
Genome map
AA seq 121 aa AA seqDB search
MAERYSSFAPGGTAWLLQRVTAAFLVVVLAFHFFLLHFVNHAAEIEFAGTQARMENVGYF
LTMVSFLVAGTFHGVNGVYNALINQGLDGTQKKVVLAVLVIASLALIAQGIYVATTMAGW
T
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacgatactcctcgttcgcgccgggcggcaccgcgtggttgctccagcgagtc
acggcggccttcttagtcgtcgtactcgccttccacttcttcctcctacacttcgtcaac
cacgccgcggagatcgagttcgccggcacccaggcccgcatggagaacgtcggctatttc
ctgacgatggtgtcgttcttggtcgcaggtaccttccacggcgtcaacggcgtctacaac
gctctgatcaaccaggggctggacggaacgcagaagaaagtcgtcctcgcagtgcttgtt
atcgcgagccttgcactcatcgcgcagggaatctacgttgcgactaccatggcggggtgg
acctaa

DBGET integrated database retrieval system