KEGG   Haloterrigena turkmenica: Htur_2208Help
Entry
Htur_2208         CDS       T01154                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
htu  Haloterrigena turkmenica
Pathway
htu00330  Arginine and proline metabolism
htu00332  Carbapenem biosynthesis
htu01100  Metabolic pathways
htu01130  Biosynthesis of antibiotics
htu01230  Biosynthesis of amino acids
Module
htu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:htu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Htur_2208
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Htur_2208
Enzymes [BR:htu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Htur_2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase Snf7 CW_7
Motif
Other DBs
NCBI-ProteinID: ADB61088
UniProt: D2RTY7
Position
2285220..2286053
Genome map
AA seq 277 aa AA seqDB search
MREGLEEPSIGAARRLAADADRVIVKAGTNSLTDADSNLDDEKLDKLVDDIEDLLKRDKE
VILVSSGSIGAGTGRIEQSSGTVEESQALSTVGQSLLMHRYTESFDRYDRKVAQLLLTQH
DLENPERFTNLRNTIETLLDWGVVPIINENDAVATEEIRIGDNDMLSAATTMGVDADLLV
TLTDVGGVYTGNPKDDDDAERIEAVGTNYDEVQEIISETTTDGFGGIQTKVEGARDVSEH
GIPAYIAKSTEPDVLEKIATAKPVGTIFVPINGVSDD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagggactcgaggaaccgagcatcggggcggcgcgacggctcgcggccgacgcc
gaccgggtgatcgtcaaggccgggacaaactccctgaccgacgcggactcgaacttggac
gacgagaaactcgacaagctcgtcgacgacatcgaggacctcctgaagcgggacaaggag
gtcattctcgtctcctcgggttcgatcggggccggcacgggccggatcgaacagtcaagt
gggaccgtcgaggagtcccaggccctctcgaccgtcggccagagtctcctcatgcaccgc
tacaccgagagcttcgaccgctacgaccggaaggtcgcgcaactgctcttgacccagcac
gacctcgagaaccccgagcgctttacgaacctgcggaacacgatcgagacgctgctggac
tggggcgtcgttccgatcatcaacgagaacgacgccgtcgcgaccgaggagatccggatc
ggcgacaacgacatgctctcggcggcgacgacgatgggcgtcgacgccgacctgctggtg
acgctgaccgacgtcggcggcgtctacaccggcaatccgaaggacgacgacgacgccgag
cgcatcgaggccgtcggtaccaactacgacgaggtccaggagatcatcagcgagaccacg
accgacggcttcggcggcatccagacgaaagtcgagggcgcgcgcgacgtcagcgagcac
ggcattccggcctacatcgcgaagtcgacggaacccgacgtgctcgagaagatcgctact
gccaaacccgtgggaaccatattcgttcccataaacggtgtgagcgatgactga

DBGET integrated database retrieval system