KEGG   Haloterrigena turkmenica: Htur_2706Help
Entry
Htur_2706         CDS       T01154                                 

Definition
(GenBank) histone acetyltransferase, ELP3 family
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
htu  Haloterrigena turkmenica
Brite
Enzymes [BR:htu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Htur_2706
Transfer RNA biogenesis [BR:htu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Htur_2706
Chromosome and associated proteins [BR:htu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    Htur_2706
   HAT complexes
    Elongator complex
     Htur_2706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Radical_SAM_C Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 SHS2_FTSA
Motif
Other DBs
NCBI-ProteinID: ADB61580
UniProt: D2RWS9
Position
2780970..2782631
Genome map
AA seq 553 aa AA seqDB search
MSTETPEPTETEAFERVCETLVERIVNGEIERDEVEKAKLEACSEHSAPKVPKNSELLDY
APQEYREDLEAVLQRKPVRTASGVSPVAIMTSPERCPHGKCLYCPGGPDSEFSSSQSYTG
EEPAAARGVQNDYDPYGQVTLRLEQLREIGHPIDKVELILMGGTMTARSHDYQEWFVKRA
LEAMNDYDVEKEPEPAEGESFAQDPEEYDWKYVEDVITENETADVRNIGTTFETKPDWCD
PEQIDRMLDLGGTKVEVGVQTTYERINREMHRGHGVQESMEANQRLRDSAFKVGFHMMPG
QPGMSKEMCLEDFRRIFEAEAWKPDYLKIYPTLIVRGTATYDWWHNGEFDPLDNDEAAEL
VAEIKDMIPRYTRLQRVQRDIPADYIDAGVWKSNLRQLARKRMDDHDWTCECIRCREAGM
NDETPENVELDVMTYDACGGTEHFISFEDFEQDLLVGFCRLRFPNDPVRPELENAALVRE
LHVYGSEVTVGDEGATDQHQHRGYGRRLMARAEELAADAGYDKVSVISGIGAREYYREKL
GYHQDGPYVSKRL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccgagacgcccgaaccgaccgaaaccgaagcgttcgagcgggtctgcgagacg
ctcgtcgagcggatcgtcaacggcgagatcgagcgcgacgaggtcgagaaagccaaactc
gaggcctgttcggaacactcggcgccgaaggtgccgaagaactccgaactgctcgattac
gcgccccaggagtaccgcgaggatctcgaggcggtcctccagcgtaagcccgtccgtacc
gcctcgggcgtctcgccggtcgcgatcatgacctcgcccgagcggtgtccccacgggaag
tgtctctactgccccggcggtcccgactcggagttctcctcctcccagagttacacgggc
gaggagcccgcggccgcccgcggggtccagaacgattacgacccctacgggcaggtgacg
ctccgactcgagcagctacgcgagatcggccaccccatcgacaaggtcgaactgatcctg
atgggcggcacgatgaccgcccggagccacgactaccaagagtggttcgtcaagcgggcc
ctcgaggcgatgaacgactacgatgtcgagaaggagcccgaaccggccgagggcgagagc
ttcgcgcaggaccccgaggagtacgactggaagtacgtcgaggacgtcatcacggaaaac
gagaccgcggacgtccgcaacatcggcaccacgtttgagaccaaacccgactggtgcgat
cccgaacagatcgatcgcatgctcgatctcggcgggaccaaagtcgaggtcggcgtccag
acgacctacgagcgcataaatcgggaaatgcaccgcggccacggcgtccaggagtcgatg
gaggccaaccagcggctgcgggattcggcgttcaaggtcggcttccacatgatgcccggc
cagcccggaatgtccaaggagatgtgtctcgaggacttccgccggatcttcgaggcggag
gcctggaagcccgactacctgaagatctacccgacgctgatcgtccgcgggacggcgacc
tacgactggtggcacaacggcgagttcgatccgctcgacaacgacgaggccgccgaactg
gtcgccgagatcaaagacatgataccccgctacacgcgcctgcagcgcgtccagcgggac
atcccggcggactacatcgacgccggcgtctggaagtcgaacctccgacagctcgcccgc
aagcggatggacgaccacgactggacctgtgagtgtatccgctgtcgcgaggccgggatg
aatgacgagacgcccgagaacgtcgaactcgacgtgatgacctacgacgcctgcggcggg
acggaacacttcatctccttcgaggacttcgagcaggacctgctggtcggcttctgccgc
ctgcggttcccgaacgatcccgtccgaccggaactcgagaacgccgcgctcgtccgcgaa
ctccacgtctacggcagcgaagtcacagtcggcgacgagggagcaacggaccagcatcaa
caccgcggctacggccgccgactcatggcccgcgccgaggaactcgccgccgacgccggc
tacgacaaggtcagcgtcatctcgggcatcggcgcccgcgagtactaccgggagaaactc
ggctatcatcaggacgggccgtacgtcagtaaacggctctga

DBGET integrated database retrieval system