KEGG   Haloterrigena turkmenica: Htur_2756
Entry
Htur_2756         CDS       T01154                                 
Name
(GenBank) phosphoenolpyruvate-protein phosphotransferase
  KO
K08483  phosphoenolpyruvate-protein phosphotransferase (PTS system enzyme I) [EC:2.7.3.9]
Organism
htu  Haloterrigena turkmenica
Pathway
htu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:htu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    Htur_2756
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:htu02000]
    Htur_2756
Enzymes [BR:htu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     Htur_2756
Transporters [BR:htu02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    Htur_2756
SSDB
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers
Other DBs
NCBI-ProteinID: ADB61629
UniProt: D2RXA5
Position
complement(2830367..2832088)
AA seq 573 aa
MAANESAPRAHEGTGVTPLSGVGTAVWYDPNAELELGEPPAAETVDPDAERERFEDARDR
ARAELERERERTAERVGEDEAAVFDAHKQFVDDPQIIDGVEAAVDDGLPAEHAVDAAFED
PIAQFEGMDGRMAERADDLRDVRDRLLRLLTDADRVDLASLSDGSILLAERLTPSDTAQL
DPERVAGFATIEGGRTSHAAIFARSLGIPAVVGVGDGLESIDDGADVLIDGEEGTVIANP
TPDQRERAAGGRDVEIREDPVETADGRAVEVAANVGTLAELEGAVAQGADGIGLFRTEFL
FLDREAPPDEDEQFEVYREALAAFPEGRVVVRTLDVGGDKPIPYLETPDADNPFLGQRGI
RRSLGPDADLFETQLRALLRAAAAESGTLSVMFPMVATVPELEAALETVADVAADLESEG
IEHERPELGAMIETPSAAFIADELAERVDFLSIGTNDLTQYVMAAARENERVADLRDPCE
PAVLRAIERTVAAADAGDAWVGMCGEMAGDPDLAPLLVGLGLDELSMSAVTIPEVKAAIA
NIETDAAEALANRATDAATRTTVYEHVNTTTDQ
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggccgccaacgagtccgcaccgcgagcgcacgagggaaccggcgtcacgccgctgtcc
ggcgtcggaaccgccgtctggtacgatccgaacgccgagctcgagcttggcgagccgccg
gcggccgaaacggtcgatccggacgccgaacgcgagcggttcgaggacgcccgcgaccgc
gcccgagcggaactcgagcgcgagcgcgaacgaaccgccgagcgcgtcggcgaggacgag
gcggcggtgttcgacgctcacaagcagttcgtcgacgatccgcagatcatcgacggcgtc
gaggcggccgtcgacgacggcctgcccgccgagcatgcggtcgacgcagccttcgaggac
cccatcgcgcagttcgaggggatggacggccggatggccgagcgcgccgacgacctccgg
gacgtgcgggaccgactgctgcgactgctcaccgacgcggatcgcgtcgacctcgcctcg
ctatcggacggctcgatcctgctggccgagcgcttgacgccgagcgacaccgcacagctc
gaccccgagcgcgtcgccggcttcgcgacgatcgagggcggtcggacctcccacgccgcg
atcttcgcccgctcgctggggatccccgccgtcgtcggcgtcggcgacggccttgagtcg
atcgacgacggcgcggacgtactgatcgacggcgaggagggcacggtgatcgccaacccg
acgcccgaccagcgcgagcgcgcggccggcggccgcgacgtcgagattcgcgaggacccg
gtcgagacggccgacgggcgcgccgtcgaggtcgcggccaacgtcggtactctcgcggaa
ctcgagggcgccgtcgcgcagggcgcggacgggatcgggctcttccggaccgagttcctc
tttctcgaccgcgaggcgccgcccgacgaggacgagcagttcgaggtctaccgcgaggcg
ctcgcggcgtttcccgaggggcgggtcgtcgtgcggacgctggacgtcggcggcgacaag
ccgattccctacctcgagacgcccgacgcggacaaccccttcctcggccagcgggggatc
cggcgctcgctcggtcccgacgctgacctcttcgagacccagctccgggcgctgttgcga
gcggccgccgccgaatcggggacgctctcggtgatgttcccgatggtggcgaccgtgccg
gagctcgaggcggccctcgagaccgtcgcggacgtcgcggccgacctcgagtccgagggg
atcgagcacgagcggccggagctgggtgcgatgatcgagacgcccagcgccgccttcatc
gccgacgagttggccgaacgcgtcgacttcctcagtatcggcacgaacgacctcacgcag
tacgtgatggccgccgcccgggagaacgagcgtgtcgccgacctccgagatccctgcgag
ccggccgtcctccgcgcgatcgagcgcaccgtcgcggccgccgacgccggcgacgcctgg
gtcgggatgtgcggcgagatggccggcgaccccgacctggcgccgctgctcgtcgggctc
gggctcgacgaactcagcatgagcgccgtcacgatccccgaggtgaaggccgcgatcgcc
aacatcgagaccgacgcggccgaagcgctcgcgaaccgagcgaccgatgcggctaccaga
acgaccgtgtacgagcacgtcaacaccaccacagaccaatga

DBGET integrated database retrieval system