KEGG   Helicobacter typhlonius: BN2458_PEG0033Help
Entry
BN2458_PEG0033    CDS       T04174                                 

Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
hty  Helicobacter typhlonius
Pathway
hty00220  Arginine biosynthesis
hty00330  Arginine and proline metabolism
hty01100  Metabolic pathways
hty01110  Biosynthesis of secondary metabolites
hty01130  Biosynthesis of antibiotics
hty01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hty00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BN2458_PEG0033
   00330 Arginine and proline metabolism
    BN2458_PEG0033
Enzymes [BR:hty01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BN2458_PEG0033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase PhageMin_Tail
Motif
Other DBs
NCBI-ProteinID: CUU38920
UniProt: A0A0S4PRD0
Position
I:complement(28876..29766)
Genome map
AA seq 296 aa AA seqDB search
MITTAKGKNMKTNASKTIRLIYPQWQGGDIAHWFKGLPKEEISKGYFLGAKLLELLTHST
SHQTLEVPVSQEFKREVKDGVLDKSDILKQTKAAMKLITESKPDKILTLGGECSVSVAPF
SYLASKYGDDVAMLWIDAHPDIGLPNDEYKAYHAMAVTHLLGLGDKEILKVLPAKIPAQN
TLLVGLHSEEAKFYAKRQKELGLKALKAKKVSSKKVLQWLQGTKASKVVIHLDLDVLDFS
EIYVAVGNSGKLKMKEVAHIIESVSAHYEIVGLSIAELMPKELIKLQNMLQKLPLM
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgattaccacagcaaaaggaaagaatatgaaaacaaatgcttcaaaaaccattcggctt
atctatccgcaatggcagggtggagacattgcgcattggtttaaagggctgcctaaagag
gagatttccaaaggctattttttaggtgcaaaactccttgaacttcttacacatagcacc
tctcatcaaacccttgaagtgcctgtttcacaagagtttaaaagagaggtaaaagacggg
gtgctagataaaagcgatattttaaagcaaaccaaagccgcaatgaaactcatcacagaa
tctaaacctgataagattctcacacttgggggtgaatgctccgtgtctgtcgcgcccttt
agctatcttgcaagtaagtatggtgatgatgtcgcaatgctatggattgacgcacaccct
gatattgggctgccaaatgatgagtataaggcttatcacgcaatggcggttacgcatttg
ctagggcttggcgataaagagattcttaaagtcctccccgcaaaaataccagctcaaaat
accttgcttgtgggattgcatagtgaggaggcaaaattttatgccaagcgtcaaaaggag
ctagggctaaaagcccttaaagcgaagaaagtaagcagcaaaaaggtcttgcaatggtta
caaggcactaaagcctctaaggttgtaatacaccttgatttagatgtgctagattttagc
gagatttatgtcgctgtgggcaatagtggcaaactcaaaatgaaagaagtcgcacacatc
attgaatctgtgagcgcacactatgaaatcgtaggcttaagtatcgccgagctaatgcca
aaggaactcattaagctacaaaatatgctccaaaaactgcctttgatgtaa

DBGET integrated database retrieval system