KEGG   Helicobacter typhlonius: BN2458_PEG0138Help
Entry
BN2458_PEG0138    CDS       T04174                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit C @ Glutamyl-tRNA(Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
hty  Helicobacter typhlonius
Pathway
hty00970  Aminoacyl-tRNA biosynthesis
hty01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hty00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN2458_PEG0138
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hty03029]
    BN2458_PEG0138
Enzymes [BR:hty01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BN2458_PEG0138
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BN2458_PEG0138
Mitochondrial biogenesis [BR:hty03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BN2458_PEG0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: CUU39025
UniProt: A0A099UCT4
Position
I:108067..108345
Genome map
AA seq 92 aa AA seqDB search
MQIDDALLSKLERLSMIRIDDKKRTQTQEQLTEIVGFVENLSAIEVPQDCFSEELKTPLR
EDIPKDSQIAKDVLSHAPKAQDNFFIVPKIIE
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattgatgatgctcttttaagtaagcttgagcgactttctatgattcgcattgat
gataagaaacgcacacagacgcaggagcagctcacagaaattgtgggctttgtagagaat
ctaagtgcaatagaagttccacaggattgctttagtgaagagttaaaaacgcccttaaga
gaagatattccaaaggattcacaaatcgctaaagatgtcttatctcacgcaccaaaggcg
caagataacttttttattgtgcctaaaatcatcgaatga

DBGET integrated database retrieval system