KEGG   Helicobacter typhlonius: BN2458_PEG0242Help
Entry
BN2458_PEG0242    CDS       T04174                                 

Definition
(GenBank) Glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
hty  Helicobacter typhlonius
Pathway
hty00860  Porphyrin and chlorophyll metabolism
hty00970  Aminoacyl-tRNA biosynthesis
hty01100  Metabolic pathways
hty01110  Biosynthesis of secondary metabolites
hty01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hty00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BN2458_PEG0242
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN2458_PEG0242
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hty01007]
    BN2458_PEG0242
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hty03016]
    BN2458_PEG0242
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:hty02048]
    BN2458_PEG0242
Enzymes [BR:hty01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     BN2458_PEG0242
Amino acid related enzymes [BR:hty01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   BN2458_PEG0242
Transfer RNA biogenesis [BR:hty03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BN2458_PEG0242
 Prokaryotic Type
   Other AARSs
    BN2458_PEG0242
Prokaryotic defense system [BR:hty02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    BN2458_PEG0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: CUU39129
UniProt: A0A099UE09
Position
I:complement(204825..206204)
Genome map
AA seq 459 aa AA seqDB search
MAQIITRFAPSPTGYLHIGGLRTALFNYLYARANGGKFLLRIEDTDLARNSLDATKAIIE
AFNWVGLEYDGEVIYQSQRFPLYKQYIQQLLDSKKAYYCYMSKEELDELRAQQEANKQTP
RYDNRYRDFTGTPPSDREPVVRIKAPLEGEICFKDGVKGEMRIQAKELDDFIIARSDGTP
TYNFVVAIDDALMGVTNVIRGDDHLSNTPKQIIVYNALGFAIPRFFHVPMILNPQGRKLS
KRDGAMGVMDYKKMGYLPEAILNFLVRLGWSYGDKEIFSLKEMCELFNPFELNSSPSAYN
EDKFLWLNAHYIKNTDNATLETLLSAFNVPCIEAGKREILYPALKDRCNTLANFAQGFFE
VMNAPQSYDEKMRSKLDEVAVANLESLFNGADSQIWESAHNMESYLHDLATQRNIKIGKL
MPTLRCALLGKSGGIGVCEALIILGQKESLERINAFLRS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaattatcacgcgctttgcgccctcgcccacaggatatttgcatatcggggga
ttgcgcacggcattatttaactatctctatgcaagagcaaatggtggtaaatttttgctt
cgtatcgaggatacggatttggcgcgaaactcacttgatgcgacaaaggcgattatagaa
gcttttaattgggtgggattagaatatgatggcgaggtcatctatcaaagccaaaggttt
cccctctacaagcaatatattcagcagttactcgattctaaaaaagcatattactgctat
atgagtaaagaggaactagacgagctaagggcgcaacaagaagcaaacaagcaaacaccg
cgttatgataatcgctaccgcgattttactggcacgccaccgagcgatagagagcctgtg
gtaaggattaaagccccgcttgaaggcgaaatatgctttaaggacggcgtgaaaggcgag
atgagaatccaagctaaagaacttgatgattttattatcgcacgaagcgatggcacaccc
acttataattttgtcgttgctattgatgatgcgcttatgggcgttacaaatgtgatacga
ggtgatgaccacttgagcaatacaccaaaacagattatcgtgtataatgcattgggcttt
gcaataccgcgattttttcacgtgccgatgattcttaaccctcaagggcgcaaacttagc
aaacgcgatggtgcaatgggagtgatggactacaaaaaaatgggctatctgcccgaagcg
attctcaacttcctcgtgcgtttgggctggagttatggcgataaggagattttctctctc
aaagaaatgtgcgaactctttaacccattcgaactaaatagctcccctagcgcatacaat
gaggataaatttttatggctcaacgcacattatattaaaaataccgataatgccacactt
gaaacgcttttaagcgcatttaatgtgccttgcatagaagcgggaaagcgtgagattctc
tatcctgcacttaaagacagatgtaatactcttgcaaacttcgcacaaggcttttttgaa
gtgatgaatgcacctcaaagctatgatgaaaaaatgcgctcaaagcttgatgaagtagca
gtggcaaatttagaatctctttttaatggagcagattcacaaatatgggaaagcgcgcac
aatatggaatcctacctgcacgacctcgctacacagcgcaatatcaaaataggcaaactt
atgccaactctgcgctgtgccttgctcggcaagagcggaggcattggcgtgtgcgaggcg
cttattatactcgggcaaaaagaaagtttggaacgcattaacgcatttttgcgtagctaa

DBGET integrated database retrieval system