KEGG   Helicobacter typhlonius: BN2458_PEG0363Help
Entry
BN2458_PEG0363    CDS       T04174                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
hty  Helicobacter typhlonius
Brite
KEGG Orthology (KO) [BR:hty00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hty03009]
    BN2458_PEG0363
Enzymes [BR:hty01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BN2458_PEG0363
Ribosome biogenesis [BR:hty03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BN2458_PEG0363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 CAF1-p150_N
Motif
Other DBs
NCBI-ProteinID: CUU39250
UniProt: A0A099UC32
Position
I:complement(312771..313883)
Genome map
AA seq 370 aa AA seqDB search
MKELIVSNIDLNNKDMNGKLRLDSLLSAYLKSSKNQIHHLIKSKKVYLNGTLCTKNGIFL
KENDHIRLDIITESNLEGSNPTHPTDSDSINPIPTPLPLDMQDKKFNIEILYQDSDILII
NKPPHLVVHQAPSLKEPTLTDWLRAHSHILHTLSGEERYGIIHRLDRQTSGALAIAKSHL
AYQILPQELKERQMGRYYLALIDKPLKSHQQIECFMGRNPHNRLKMSKIYIRPNAPIPKG
VRDSKSSFIKLATADNGKCELVAVKLHTGRTHQIRTHLESLSRHILGDTLYGYKKGTESY
HYDNRILLHAYILYLNHPRNKENYIFKAPILTDMLEFLQNHFTKDLPDDCQNIMDLLEVD
RIIDAFHIFP
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattaattgtatcaaatattgacttaaacaacaaagatatgaatggtaaattg
cggctagattcgcttctaagcgcatatctcaaaagcagcaaaaaccaaatccaccacctc
atcaaaagcaaaaaagtctatcttaatggcacactttgcacaaaaaatggcatatttctt
aaagaaaatgaccacataaggctagatattattacagaatctaatcttgagggttctaat
cctacgcaccccacagattcagattctataaatcccatccccactccacttcctcttgat
atgcaggataaaaaatttaatattgagattctctatcaagatagcgatattttaattatc
aataaaccgcctcatcttgtcgtgcatcaagccccaagccttaaagaaccaaccctcact
gattggcttagggcacattcgcatatcctgcatacattaagtggcgaggagcgatatggc
attattcatcgcctcgatagacaaacaagcggggctttagccattgcaaaatcccacctt
gcatatcaaatcctcccccaagagctaaaagagcggcaaatgggacgctattacctcgca
cttattgataagcccttaaaatctcatcagcaaatagaatgctttatggggcgcaatccc
cacaatcgcctcaaaatgagcaagatttatattcgcccaaatgcgcctattcctaagggt
gtgcgggattccaaaagctcctttatcaaactcgccactgcggataatggtaaatgtgag
ttagtagcagtgaagctccacacaggcaggacgcaccaaatccgcacacaccttgaaagc
ctctctcgccatatccttggcgatacactctatggatacaaaaagggcacggagagctac
cattacgataatagaattttgctccacgcctatatactttatctcaaccacccgcgcaac
aaagaaaattatatctttaaagcccccattttgacagatatgctagaatttctccaaaat
cattttacaaaggatttgcccgatgactgccaaaacattatggacttgcttgaagttgat
aggattattgacgcctttcatatttttccttaa

DBGET integrated database retrieval system