KEGG   Helicobacter typhlonius: BN2458_PEG0406Help
Entry
BN2458_PEG0406    CDS       T04174                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
hty  Helicobacter typhlonius
Pathway
hty00520  Amino sugar and nucleotide sugar metabolism
hty01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hty00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BN2458_PEG0406
Enzymes [BR:hty01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     BN2458_PEG0406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-ProteinID: CUU39292
UniProt: A0A099UHZ0
Position
I:348066..349004
Genome map
AA seq 312 aa AA seqDB search
MLNKKVLVTGGAGFLGSHLCEKLLERGDEVLCVDNLFTGTKQNIIHLLSNPRFEFMRHDV
TFPLYVEVDEIYNLACPASPVHYQFDPVQTTKTSVMGAINMLGLAKRVKAKILQASTSEV
YGDPEIHPQVESYKGSVNPIGIRACYDEGKRCAETLFFDYQRQHNLNIKVMRIFNTYGPR
MHPNDGRVVSNFIIQALKGEDVTIYGEGKQTRSFCYVDDLIEGMIRLMDSRDGFYGPVNI
GNPREFSMIELANAVLELTHSKSKLVFSPLPQDDPKQRQPDISLAQNELGWNPNVELKEG
LIKTIAYFKEII
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcttaataaaaaagttttggtaaccggtggagcgggatttttaggctcacatttatgc
gaaaagctactagagaggggcgatgaagtgctttgtgtggataatcttttcacaggcaca
aaacaaaatattatacatttactctcaaatccccgttttgaatttatgcgccacgatgta
acttttcctctctatgtagaagttgatgaaatttataatctcgcttgccctgcttctcca
gtgcattatcaatttgacccagtgcaaacaactaaaacttctgttatgggagcaatcaat
atgctaggacttgcaaagagagtgaaagcgaagattctgcaagcaagcacgagtgaagtt
tatggcgatcctgaaatccacccacaagtagaatcctacaaaggctcagtgaatcctatt
ggcataagggcgtgttatgatgaggggaagcgatgtgcagaaacacttttttttgattat
caaaggcagcataatttaaatattaaagtaatgagaatttttaatacctatggacctaga
atgcacccaaacgatgggcgtgtagtaagtaattttatcattcaagcactcaaaggcgaa
gatgttacgatttatggcgaaggcaagcaaactcgtagtttttgctatgtagatgatttg
attgagggtatgataagacttatggatagtagagatggattctatggacctgtaaatata
gggaatccacgtgaatttagtatgattgaacttgcaaatgcagtgctagagctcactcac
tctaaatccaaacttgttttttcacccttacctcaagatgacccaaaacaacggcaaccc
gatattagccttgctcaaaatgagctagggtggaatccaaatgttgagcttaaagaaggg
ctaataaaaacaattgcgtattttaaggaaattatatga

DBGET integrated database retrieval system