KEGG   Helicobacter typhlonius: BN2458_PEG1595Help
Entry
BN2458_PEG1595    CDS       T04174                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
hty  Helicobacter typhlonius
Pathway
hty00450  Selenocompound metabolism
hty00970  Aminoacyl-tRNA biosynthesis
hty01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hty00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BN2458_PEG1595
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BN2458_PEG1595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hty01007]
    BN2458_PEG1595
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hty03016]
    BN2458_PEG1595
Enzymes [BR:hty01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BN2458_PEG1595
Amino acid related enzymes [BR:hty01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BN2458_PEG1595
Transfer RNA biogenesis [BR:hty03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BN2458_PEG1595
 Prokaryotic type
   Other AARSs
    BN2458_PEG1595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 DUF2072
Motif
Other DBs
NCBI-ProteinID: CUU40478
UniProt: A0A099UDT1
Position
I:complement(1437143..1439089)
Genome map
AA seq 648 aa AA seqDB search
MQTKTYITSPIYYVNDIPHIGHSYTTFLCDMLKKFYQLQGQDVVFTTGTDEHGQKIEQSA
QKHQLSPQDYADKISIRFKELWNEFNIDYDIFVRTTDKAHCLSVQKAFEIMYVKGDIYKG
SYEGHYCISCESFFTQTQLGANNSCPDCGKPTQIVQEESYFFALSKYQERLLAHFAKNPT
MITPSFYQNEIINFISNGLNDLSITRTSFEWGVPLLSNPARKDDKAHVMYVWLDALLSYL
SPLGYLSNEAKMPYWDNAVHFVGKDILRFHAVYWLAFLMSLDLPLPKHIYTHGWWTRDGA
KMSKSIGNVINPKEMAATYGTESLRYFLLREMPFGQDGDFSERVLIERINAELSNDVGNL
LNRLLGMGEKYFSLIIDSKDVATHFADEINELHSHIDKVCEKMMQMQPHRYIEELWKIYA
LGNNAISKYEPWKLIKNNQQEPAMALLGLIANILAKSAILLYPIMPQSAAKIAHVLRFSI
NEQSFERFITKKELLQPLTLEKIPPLFPRIQEEAKASDCKNTQSSAKSIKTAKEDSKDLE
SYIDIKDFKKLDIRIGTILECSAMEKSHKLLKLLVDVGEEKPRQILSGISQHYSPESLLN
KQVCVIVNLKPAKLMGEISEGMILASEDENGLSLLGLDKARANGSRIS
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaaagacttatatcacttcacctatttattatgtcaatgatataccacatatc
gggcattcttacacaacttttttatgcgatatgcttaagaaattttatcaacttcaaggg
caagatgtggtttttactactggcacggacgaacacgggcaaaaaatcgagcaatccgcg
caaaagcaccaacttagcccacaagactacgcagacaaaattagcataagattcaaagaa
ttatggaatgaatttaatatagactatgatatttttgtgcgcaccacggataaggcacac
tgcttaagtgtgcaaaaagcttttgagataatgtatgtaaagggagatatttacaagggt
agttacgaggggcattactgcatttcgtgtgagagctttttcacacaaacacagcttgga
gcaaacaactcttgcccagattgtggcaaaccaacacaaatcgtgcaggaggagagttac
ttttttgcacttagcaaatatcaggagaggcttttagcccattttgctaagaatcctaca
atgataactcctagcttctatcaaaatgagattatcaattttataagcaatgggttaaat
gacctctcaatcacgcgcacaagctttgaatggggtgtgccgctcttgtcaaatcctgcg
cgcaaagatgataaagcccacgtgatgtatgtgtggcttgatgcacttctaagctaccta
agccccttaggctatctctctaatgaagcaaaaatgccttattgggataatgccgtgcat
tttgtgggaaaggatattttgcgttttcacgcggtgtattggcttgcctttttaatgagc
cttgatttgcccctacctaagcatatctatacgcacgggtggtggacgagagatggtgcg
aagatgagtaagagtatcggcaatgtaatcaatcccaaagaaatggctgccacttatggc
actgaatctttgcgctattttttactgcgtgaaatgccctttgggcaagatggcgacttt
agcgagcgagtgcttattgagcgcataaatgccgagcttagcaatgatgtgggtaatctc
cttaatcgcctacttggaatgggtgagaagtattttagtcttattatagattctaaagat
gtggcgacacattttgccgatgagattaacgagcttcattcacacattgataaagtttgc
gaaaaaatgatgcaaatgcagcctcatcgctacattgaggagctgtggaaaatctacgca
cttggcaataatgccatcagtaaatacgagccgtggaaactcatcaaaaataatcagcaa
gaacccgctatggcattacttggcttaattgcaaatatcctcgctaaaagtgcgattttg
ctctatcctattatgcctcaaagtgccgctaaaatcgctcacgtgctaagatttagtatt
aatgagcaaagctttgaaagatttatcactaaaaaagagcttttgcaaccgcttactttg
gagaaaatccctccacttttcccacgcatacaagaggaggcaaaggcgagtgattgtaaa
aatacacaatctagtgcaaaatcaataaaaacagctaaagaagattctaaggatttagaa
tcctatattgacatcaaagattttaagaagcttgatatacgtataggcacgattttagaa
tgctccgcaatggaaaaaagtcataaactccttaagttactcgtagatgtgggcgaggag
aagccacggcagattctatcgggcatatcacagcattacagcccagaatctctgcttaat
aagcaagtatgcgtgatagtcaatctcaaaccagccaagcttatgggcgaaataagtgag
ggaatgatacttgctagtgaagatgaaaatggcttatcgcttctaggtttagacaaggca
cgagcgaatgggagtaggataagctag

DBGET integrated database retrieval system