KEGG   Humibacter sp. BT305: DVJ78_07290Help
Entry
DVJ78_07290       CDS       T05558                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
hum  Humibacter sp. BT305
Pathway
hum00020  Citrate cycle (TCA cycle)
hum00620  Pyruvate metabolism
hum01100  Metabolic pathways
hum01110  Biosynthesis of secondary metabolites
hum01120  Microbial metabolism in diverse environments
hum01130  Biosynthesis of antibiotics
hum01200  Carbon metabolism
Module
hum_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hum_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hum00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DVJ78_07290
   00620 Pyruvate metabolism
    DVJ78_07290
Enzymes [BR:hum01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     DVJ78_07290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AXH37226
UniProt: A0A345K2Y7
Position
1531362..1532867
Genome map
AA seq 501 aa AA seqDB search
MSTKSVDVILIGGGIMSATLGTMIKQLQPDWSIVLFERLNDVALESSNPWNNAGTGHAAL
AELNYMPEAADGTMEPSKAININEQFQVSRQFWASLVESGVLDAPTTFINPTPHMTFVRG
ADNVDYLRRRWEILKDEPLFEGIEFSDDPRQIYKWAPLLMRHRQKDEKIAATRITSGTDV
DFGSLTHQLVDYLRANGVDYRSETTVKGLKKQKDGSWTVRVRERIGGTPYSINGKFVFVG
AGGGALSLLQKSGIPEIKGFGGFPISGKFFRTDNPEIVAQHQAKVYGKASVGAPPMSVPH
LDTRVVDGQASLLFGPYAGFSPKFLKSGSWFDLPGSIRLHNLGPMLAVARDNFDLVKYLI
GELLASRSKKLEALREFMPTAQSKDWRLITAGQRVQVMKKDPKRGGVLQFGTEVVTSADG
TIAGLLGASPGASTAVPIMIDLIRKCFPAESAAWEPKLKQLVPSLGTKLNADPAAAEQSL
DETAKVLDLTRSDERAVATAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacaaagagcgtggatgtcatcctgatcggcggcggcatcatgagtgccaccctc
ggcacgatgatcaagcagttgcagcccgactggtcgatcgtcctcttcgagcggctgaac
gacgtcgccctcgagagctcgaacccgtggaacaacgccggcaccggtcacgcagcgctc
gccgagctcaactacatgcccgaggcggcagacggcacgatggagccgtcgaaggccatc
aacatcaacgagcagttccaggtgagccgtcagttctgggcctccctcgtcgagtccggc
gtgctcgatgcgcccaccaccttcatcaaccccacgccccacatgaccttcgtgcgcggc
gccgacaacgtcgactacctccgccggcgctgggagatcctgaaggacgagccgctcttc
gagggcatcgagttcagcgacgacccccgccagatctacaagtgggcgccgctgctcatg
cgccaccgtcagaaggacgagaagatcgcggcgacccgcatcaccagcggcaccgacgtc
gacttcggttcgctcacgcaccagctcgtcgactacctccgagccaatggcgtcgactac
cgcagcgagacgaccgtcaagggcctcaagaagcagaaggacgggtcgtggaccgtccgt
gtccgcgaacgcatcggcggcacgccctactcgatcaacggcaagttcgtcttcgtcggt
gctgggggaggggcgctgtcgctcctgcagaagtccggcatccccgagatcaaggggttc
ggcgggttcccgatcagcggcaagttcttccgcaccgacaaccccgagatcgtcgctcag
caccaagcgaaggtgtacggcaaggcctccgtgggcgccccgcccatgtcggtgccgcac
ctcgacacccgcgtcgtcgacggccaggcgtccctgctcttcggcccgtacgcgggcttc
agcccgaagttcctcaagtctggctcgtggttcgacctgcctgggtccatccgcctgcac
aacctcgggccgatgctcgccgtcgcgcgcgacaacttcgatctggtgaagtacctcatc
ggcgagctgctcgcgagtcgcagcaagaagctcgaggcgctccgcgagttcatgccgacg
gcccagtccaaggactggcgcctcatcacggccggccagcgcgtccaggtcatgaagaag
gacccgaagcgcggcggggtgctgcagttcggcaccgaggtggtcacctccgccgacggc
acgatcgccggcctgctcggtgcgtcgcccggtgcgtccacggccgtgccgatcatgatc
gacctcattcgcaagtgcttcccggccgagtcggccgcgtgggagccgaagctcaagcag
ctcgtcccgtcgctcggcaccaagctcaacgccgatcccgcagccgcagagcagtcgctc
gacgagaccgccaaggtcctcgacctcacgcggtccgacgagagggccgtggccacggcg
agctga

DBGET integrated database retrieval system