KEGG   Humibacter sp. BT305: DVJ78_08790Help
Entry
DVJ78_08790       CDS       T05558                                 

Definition
(GenBank) SDR family NAD(P)-dependent oxidoreductase
  KO
K10780  enoyl-[acyl-carrier protein] reductase III [EC:1.3.1.104]
Organism
hum  Humibacter sp. BT305
Pathway
hum00061  Fatty acid biosynthesis
hum01100  Metabolic pathways
hum01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:hum00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    DVJ78_08790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hum01004]
    DVJ78_08790
Enzymes [BR:hum01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.104  enoyl-[acyl-carrier-protein] reductase (NADPH)
     DVJ78_08790
Lipid biosynthesis proteins [BR:hum01004]
 Fatty acid synthase
  Component type
   DVJ78_08790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase DUF4811
Motif
Other DBs
NCBI-ProteinID: AXH35491
UniProt: A0A345JY02
Position
complement(1859000..1859842)
Genome map
AA seq 280 aa AA seqDB search
MTDSTQRIVAITGASRGIGRLLAQKLGAQGAAVVINYKVNADLAEESLADVVAAGGSGIT
VQADIEQADDIDALFDRIRSEYGRLDGFVANAAASAFKPVSALKTHHLDRSYAMNTRSFV
LGAIRAAELMDAGGRIVAVTSYGSLRAFPTYAALGAAKAANEAYVKFMATEFGPRQITVN
AVNGGLIDTDSLDYFYNRVPGMAPMESVLAKVPLQRPGTADDMADAIDFLLSDRASYITG
QVISVDGGLTVVAPPFWADTTGDLRAAVMLDGPDPSVLPE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactcgacccagcgcatcgtcgccatcaccggagcctcccgcggcatcgggcgc
ctgctcgcccagaagctcggggcgcagggggcggccgtcgtcatcaactacaaggtgaac
gccgacctcgccgaggagtcgctcgccgacgtcgtcgccgccggcggctcgggcatcacg
gtgcaggccgacatcgagcaggccgacgacatcgacgcgctcttcgaccgcatccgctcc
gagtacggccggctcgacgggttcgtcgccaacgccgccgcgagcgcgttcaagcccgtc
tcggcgctgaagacccaccacctcgatcgcagctacgccatgaacacccggtcgttcgtg
ctcggcgccatccgagcggcggagctcatggacgccggcggacgcatcgtggcggtgacg
agctacggctcgctccgcgccttccccacctacgcggcgctcggcgcggcgaaggcggcg
aacgaggcctacgtgaagttcatggccaccgagttcggcccgcgccagatcaccgtgaac
gcggtcaacggcgggctcatcgacaccgactccctcgattacttctacaatcgcgtgccg
gggatggcgcccatggagtccgtgctggcgaaggtgccgctgcagcgcccagggaccgcg
gacgacatggcggacgcgatcgacttcctgctctcggaccgtgcgtcgtacatcaccggc
caggtgatctcggtcgacggcgggctgaccgtggtcgccccgccgttctgggccgacacg
accggcgacctccgggccgccgtgatgctcgacgggccggacccgtcggtgctccccgag
tga

DBGET integrated database retrieval system