KEGG   Halorhabdus utahensis: Huta_1372Help
Entry
Huta_1372         CDS       T00971                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
hut  Halorhabdus utahensis
Pathway
hut00330  Arginine and proline metabolism
hut00332  Carbapenem biosynthesis
hut01100  Metabolic pathways
hut01130  Biosynthesis of antibiotics
hut01230  Biosynthesis of amino acids
Module
hut_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Huta_1372
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Huta_1372
Enzymes [BR:hut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Huta_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ACV11548
UniProt: C7NNE8
Position
complement(1346312..1347145)
Genome map
AA seq 277 aa AA seqDB search
MSDAIDPEEIERTRELAADAERVVVKAGTNSLTDAESNLDDAKLDKLVDDVADLLDHGKE
VLLVSSAAIGAGRGRVDAETDTVEASQALSTVGQSHLMRRYTESFERYDRKVAQILVTQA
DLDDPERFTNFHNTVETLLDWGIVPIVNENDAVAIAEIQIGDNDMLSSSIAVGIEADLLV
TLTDVDGVYTGNPKDDPDATKIEAVGSNYGAVQEIVAQSTTEEFGGITTKVEGARTANEH
GIPAVIAGSAEPDVLARIAAGESVGTIFLPVNGAYDD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgccatcgaccccgaagagatcgagcggacgcgcgaactcgccgccgacgcc
gagcgggtcgtcgtcaaggcggggacgaactccctgacggacgccgagtcgaacctcgac
gacgcgaaactcgacaagctcgtcgacgacgtggccgacctgctcgatcacggcaaggag
gtcctgctggtctcttcggcggcgatcggggccggccggggacgcgtcgacgcagagacc
gacaccgtcgaagcgtcccaggcgctgtcgaccgtcggccagagccatctgatgcgccgg
tataccgagagcttcgagcgctacgatcggaaggtcgcccagattctggtcacgcaggcc
gacctggacgatcccgagcggttcaccaacttccacaacactgtcgagacgctgctggat
tgggggatcgtcccgatcgtcaacgagaacgacgccgtcgcgatcgcggagatccagatc
ggcgacaacgacatgctctcctcgtcgatcgcggtcgggatcgaggccgacctgctggtg
acgctgaccgatgtcgacggcgtctacaccggcaacccgaaggacgatcccgacgcgacc
aagatcgaggccgtcgggagcaactacggggccgtccaggagatcgtcgcccagagcacg
accgaggaattcggcgggatcacgacgaaggtcgagggcgcgcgaacggccaacgagcac
gggatcccggcggtgatcgcgggctcggccgaaccggacgtgcttgcccgcatcgccgcc
ggcgaatcggtgggcacaatattcttgcctgtcaacggagcatacgatgactga

DBGET integrated database retrieval system