KEGG   Halorhabdus utahensis: Huta_1794Help
Entry
Huta_1794         CDS       T00971                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
hut  Halorhabdus utahensis
Pathway
hut00860  Porphyrin and chlorophyll metabolism
hut01100  Metabolic pathways
hut01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hut00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Huta_1794
Enzymes [BR:hut01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Huta_1794
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Huta_1794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_3 Pyr_redox_2 FMO-like FAD_binding_2 Pyr_redox_3 NAD_binding_9 3HCDH_N Thi4 Pyr_redox HI0933_like NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ACV11966
UniProt: C7NRN0
Position
complement(1799947..1801206)
Genome map
AA seq 419 aa AA seqDB search
MTVAVIGAGMSGLSTTHFLAEQGAEVRTFEASDEPGGIVRSTTVEGHVLERGPQRLRLSK
PVESLVETLDLRDELRFGDDDQPLFAYDDGQLRRMPLSVRDAITTDLLSWRGKARVLLEP
LTGGAKPNETVEAYLTRKFGHEVATRFAGPLYSGLYGTDADDMYVEYSLGKALDRFGVEG
SLLVFMLKKLLQGTETPPIVSFEDGLQTLPEAMYAAHEESIDLETPVTGVEPDGEDYLVH
TEDGTERAETVVFTTPAPTTAALLEDVDSEAAETVSQFAYNPIGVVHLHSDFDGTGHGFH
IIDDGFKTDGSTWNHSMLGRDGVFTSYVGSGDSEFLDADPAVIGRRAAEEFETVTGAAAT
VLDAAVLRPGMPAYDRSWAALDELSLPDEIEICASFMSRAGIVGRIAGGKRTAATIAEE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcgccgtcatcggggccgggatgtccggactctcgacgacgcactttctcgcg
gagcaaggggccgaggtcaggaccttcgaggcctcggacgagccgggcggtatcgtccgg
tcgacgacggtcgagggccacgtcctcgaacggggaccacagcgactccgcctctcgaag
ccagtcgaatcgctggtcgagacgctcgatcttcgtgacgaattacgcttcggcgacgac
gaccagcccctctttgcctacgacgacggacagctccgccggatgccactgtcggtccgg
gacgcgatcacgacggatctgctctcctggcgcggcaaggcccgcgtcctgctcgaaccg
ctgactggcggggcaaagccgaacgagaccgtcgaggcgtacctcacccggaagttcggg
cacgaagtcgcgacccggttcgcgggcccgctgtacagcggtctctacggcacggacgcc
gacgacatgtacgtcgagtactcccttggcaaggcgctcgatcgcttcggcgtcgagggg
agcctgcttgtgttcatgctgaagaagttgctgcaggggaccgagacacccccgatcgtc
tccttcgaggacggcctccagacactcccggaggcgatgtatgcggctcacgaggaatcg
atcgacctcgaaacgcccgtgaccggggtcgagccggacggcgaagactatctcgtccac
accgaggacgggaccgagcgggccgagaccgtcgtgttcaccacaccggccccgacgaca
gccgcactgctcgaagacgtcgacagcgaggccgccgaaacggtcagccagttcgcctac
aacccgatcggcgtcgtccacctccattcggacttcgacggcacgggccacggctttcac
atcatcgacgacggattcaaaacggacggcagcacctggaatcacagcatgctcggccgc
gatggcgtgttcacgtcctacgtcggcagcggcgattcggagttcttagacgccgacccc
gcggtcatcggacgacgagcggccgaggagttcgagaccgtcaccggcgcggcggccacc
gtccttgacgcggccgtcctccggcccgggatgccggcctacgaccgatcgtgggctgcg
ctggacgagctttcgcttccggacgagatcgagatctgtgcgagtttcatgagtcgagcc
gggatcgtgggtcggatcgccggcggcaagcggacggcagcgactatcgccgaggaataa

DBGET integrated database retrieval system