KEGG   Humibacter sp. WJ7-1: FPZ11_09515Help
Entry
FPZ11_09515       CDS       T06119                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
huw  Humibacter sp. WJ7-1
Pathway
huw03010  Ribosome
Brite
KEGG Orthology (KO) [BR:huw00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FPZ11_09515
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:huw03011]
    FPZ11_09515
Ribosome [BR:huw03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FPZ11_09515
  Bacteria
    FPZ11_09515
  Archaea
    FPZ11_09515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Peptidase_M26_N
Motif
Other DBs
NCBI-ProteinID: QDZ14968
Position
complement(2050380..2050745)
Genome map
AA seq 121 aa AA seqDB search
MVESIARVRHIRVTPQKARRVVNLIRGKQAQEALAILKFAPQGASEPVYKLVASAIANAR
VKADATNQYLDERDLYVSRAFVDEGTTLKRFQPRAQGRAFRINKRTSHITVVLATPDEGT
K
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggtggagtcgatcgcacgcgtgcgacacatccgcgttacgcctcagaaggctcgtcgc
gtcgtcaacctgatccgcggcaagcaggcgcaggaggccctggccatcctgaagttcgcc
ccgcagggcgcgagcgagccggtctacaagctcgtggcatccgcgatcgcgaatgcccgg
gtcaaggccgacgcaacgaaccagtacctcgacgagcgcgacctctatgtgagccgtgcc
ttcgtcgacgagggaacgacgctcaagcggttccagccgcgcgctcagggccgtgcgttc
cgcatcaacaagcgcaccagccacatcaccgttgtgctggccacacctgacgaggggacg
aagtaa

DBGET integrated database retrieval system