KEGG   Halomonas venusta: EI420_00170Help
Entry
EI420_00170       CDS       T05892                                 

Definition
(GenBank) glutathione synthase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
hvn  Halomonas venusta
Pathway
hvn00270  Cysteine and methionine metabolism
hvn00480  Glutathione metabolism
hvn01100  Metabolic pathways
Module
hvn_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:hvn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EI420_00170
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EI420_00170
Enzymes [BR:hvn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     EI420_00170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AZM94201
UniProt: A0A3S8YMH4
Position
37480..38436
Genome map
AA seq 318 aa AA seqDB search
MSQSTLHLGVVMDPISDIAYKKDTTMAMLWAAQERGYTLHYMEQEDLFLNAGQAYARMRP
LTVHRDPNHWYDLGEAAQRPLVELDVVLMRKDPPVDADFTNAVHLLGFAEREGVLVVNPT
AALLQCNEKLFAQQFPQCCAPTIVASRDDVLRAFHAEHGDVIFKPLDGMGGTGIFHIGPD
GRNIGAVIEQLTLRGQRQIMAQRYLAEIKDGDTRILLVDGEPVPYGLARIPSAGETRGNL
AAGGRGVSRELTERDHWLIQQVQPMIREKGLMFVGLDVIGDYITEINVTSPTCVREIDDQ
RGTDIAGMLLDAIERRLN
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagccaatcaacgttgcatctcggtgtggtgatggatcccatcagcgacatcgcttac
aagaaagataccaccatggccatgctgtgggcggcgcaagagcgcggctacacactgcac
tatatggagcaagaagatcttttcttgaacgcagggcaggcttatgcacgtatgcgccca
ttaacggtgcatcgcgatcctaaccattggtacgacctcggtgaagcggctcagcgccca
ctggtggaattggatgttgtgctaatgcgcaaagatccgcctgtcgatgccgactttacc
aatgcggttcatttgctggggtttgctgagcgggaaggcgttctggtggttaatccaacg
gcggcgctgttgcagtgtaatgaaaagctatttgcccagcagtttccccagtgctgtgcg
cccaccattgtcgccagtcgtgatgacgtcctgcgtgctttccacgcggagcatggtgat
gtgattttcaaaccccttgatggcatgggcggtacagggatttttcatatcggccctgat
ggccgcaatatcggcgcggttattgagcaattaaccctgcgcggccagcggcaaattatg
gcgcaacgctacctagccgaaatcaaagatggcgacacgcgcattttattggttgatggt
gagcccgtgccctatgggctggcgcgtattccctcggcgggtgaaacgcgcggtaacctc
gccgctggagggcgtggtgttagccgtgagctgactgagcgtgaccactggttgattcag
caggtgcagcccatgattcgcgaaaaagggctgatgtttgttggtttagatgtgattggt
gactacatcacagaaattaacgtcaccagtcctacctgtgtacgtgaaattgatgatcag
cgcggcacggacattgccggaatgctgctggatgctattgaacgtcgccttaactaa

DBGET integrated database retrieval system