KEGG   Halomonas venusta: EI420_00935Help
Entry
EI420_00935       CDS       T05892                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
hvn  Halomonas venusta
Pathway
hvn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:hvn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    EI420_00935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hvn03011]
    EI420_00935
Ribosome [BR:hvn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    EI420_00935
  Bacteria
    EI420_00935
  Archaea
    EI420_00935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF5357
Motif
Other DBs
NCBI-ProteinID: AZM94336
UniProt: A0A3S8YMS0
Position
203531..203863
Genome map
AA seq 110 aa AA seqDB search
MEVTAKLSGAALSAQKARLVADQVRGKPVAEALDLLTFSPKKAAKLVKKVLQSAIANAEE
NNGMDIDELRVSTICVDEGMTLKRIKPRAKGRADRILKRTCHITVKVAEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcacagctaagctgagtggcgctgctttatccgcacagaaggcccgtttggtg
gctgaccaggtgcgcggtaaaccggtcgccgaagctcttgacctgctgaccttctcaccg
aagaaggctgccaaactggtcaagaaagtgcttcagtccgccatcgcgaatgcggaagaa
aataacggcatggacatcgacgagctgcgtgtctcgaccatctgcgtcgatgagggcatg
acgctcaagcgtatcaagccgcgcgccaaaggccgtgcggatcgtatcttgaagcgcacc
tgccacatcaccgtcaaggtagccgagaagtag

DBGET integrated database retrieval system