KEGG   Haloferax volcanii: HVO_0087Help
Entry
HVO_0087          CDS       T01200                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
hvo  Haloferax volcanii
Pathway
hvo00860  Porphyrin and chlorophyll metabolism
hvo01100  Metabolic pathways
hvo01110  Biosynthesis of secondary metabolites
hvo01120  Microbial metabolism in diverse environments
Module
hvo_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:hvo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HVO_0087 (hemB)
Enzymes [BR:hvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HVO_0087 (hemB)
Exosome [BR:hvo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HVO_0087 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD DUF1684
Motif
Other DBs
NCBI-ProteinID: ADE02518
UniProt: D4GYT2
Position
complement(87625..88608)
Genome map
AA seq 327 aa AA seqDB search
MKFTDRPRRLRTDGIRPLVSETTLDATDLVAPVFVDATTDERVPIESIPGHERVPVAEAA
DRVAEVREAGVKAVIVFGIPESKDPEGSRAYARNGVVQEAVRAITAETDAYVITDVCLCE
YTDHGHCGVLEDHAEDDPTLTVENGPTLDLLAETAVSHAEAGADMVAPSASMDGMVGAIR
TALDDAGHDEIPIMSYAAKYESAFYGPFRDAADGAPAFGDRRHYQMDPANAREALREVAL
DVEQGADVLMVKPGLPYLDIVRAIREGYDHPVAAYNVSGEYAMLHAAAEKGWLDLDGVAH
ESLLSMKRAGADLIITYFAERVARQLD
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcaccgaccgcccccgcaggcttcgaaccgacgggattcggccgctcgtctcg
gagacgaccctcgacgcgaccgacctcgtcgcgcccgtcttcgtggacgcgacgaccgac
gagcgcgtccccatcgaatccatcccgggccacgagcgcgtgccggtcgcggaggcggcc
gaccgcgtcgccgaggtgcgcgaggccggcgtcaaggccgtcatcgtcttcggtatcccc
gagtcgaaagaccccgaggggtcccgagcgtacgcgcgaaacggggtcgtacaggaggcc
gtccgcgccatcaccgccgagacggacgcctacgtcatcaccgacgtctgtctctgtgag
tacaccgaccacggccactgcggcgtgctggaggaccacgccgaagacgacccgacgctg
acggtcgaaaacgggccgacgctggacctgctcgcggagacggccgtctcccacgccgag
gcgggcgcggacatggtcgccccctcggcctcgatggacgggatggtcggcgcgattcgc
acggcgctcgacgacgccggtcacgacgagatacccatcatgtcctacgccgcgaagtac
gagagcgccttctacggccccttccgcgacgcggccgacggcgcgccggcgttcggtgac
cgacggcactaccagatggaccccgcgaacgcccgggaggcgctgcgcgaggtcgccctc
gacgtcgaacagggcgcggacgtgctgatggtcaagccgggcctgccgtacctcgacatc
gtccgcgccatccgcgagggctacgaccacccggtcgccgcctacaacgtctccggcgag
tacgcgatgctccacgccgccgccgagaagggctggttggacctcgacggggtcgctcac
gagtcgctcctgtcgatgaaacgggcgggcgcggacctcatcatcacgtacttcgcagag
cgcgtggcgcggcagctcgactga

DBGET integrated database retrieval system